HiSeq13079_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13079
Unique NameHiSeq13079_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length96
Homology
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|946724954|gb|ALM30329.1| (myosuppressin precursor [Chilo suppressalis])

HSP 1 Score: 165.236 bits (417), Expect = 2.209e-51
Identity = 83/97 (85.57%), Postives = 85/97 (87.63%), Query Frame = 0
Query:    1 MSRSIEYRAAVLVALACVVASAV-CAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            M +S E R A L  L C VA AV CAPAP+CAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEY ALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:    1 MMKSTETRVAALCVLLCFVARAVNCAPAPICAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYHALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 97          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|15825168|gb|AAL09583.1|AF390443_1 (manducaFLRFamide I precursor [Mythimna unipuncta])

HSP 1 Score: 153.68 bits (387), Expect = 8.042e-47
Identity = 77/91 (84.62%), Postives = 82/91 (90.11%), Query Frame = 0
Query:    6 EYRAAVLVALACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
             + A V + LAC  + A+CAPA LCAGAA+DDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:    8 NHVAVVCLVLACA-SVALCAPAQLCAGAADDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 97          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|1062563083|dbj|BAV57610.1| (myosuppressin [Mamestra brassicae])

HSP 1 Score: 153.295 bits (386), Expect = 1.168e-46
Identity = 77/88 (87.50%), Postives = 81/88 (92.05%), Query Frame = 0
Query:    9 AAVLVALACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            A V + LAC  + A+CAPA LCAGAA+DDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:   11 AVVCLVLACA-SVALCAPAQLCAGAADDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 97          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|464897597|gb|AGH25562.1| (myosuppressin [Helicoverpa armigera])

HSP 1 Score: 152.91 bits (385), Expect = 2.183e-46
Identity = 76/93 (81.72%), Postives = 81/93 (87.10%), Query Frame = 0
Query:    4 SIEYRAAVLVALACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            ++ + A V V LA    +A  APA LCAGAA+DDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:    5 NVHHLAVVCVVLAWCACAARSAPAQLCAGAADDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 97          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|913310906|ref|XP_013186110.1| (PREDICTED: myosuppressin-like [Amyelois transitella])

HSP 1 Score: 152.14 bits (383), Expect = 3.607e-46
Identity = 77/90 (85.56%), Postives = 81/90 (90.00%), Query Frame = 0
Query:    8 RAAVL-VALACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            R AVL + L+    +A+ APAPLCAGA EDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:    9 RLAVLCLVLSWCALTALSAPAPLCAGAVEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 98          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|166997946|emb|CAO86065.1| (myosuppressin precursor, partial [Spodoptera littoralis])

HSP 1 Score: 148.673 bits (374), Expect = 5.261e-45
Identity = 71/77 (92.21%), Postives = 74/77 (96.10%), Query Frame = 0
Query:   20 ASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
             +A+CAPA LC GAA+DDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
Sbjct:    6 GAALCAPAQLCGGAADDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 82          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|357605226|gb|EHJ64518.1| (manducaFLRFamide I precursor [Danaus plexippus])

HSP 1 Score: 146.747 bits (369), Expect = 4.890e-44
Identity = 72/81 (88.89%), Postives = 73/81 (90.12%), Query Frame = 0
Query:   15 LACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRR 95
            L   VAS + APA LC  AAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRR
Sbjct:   16 LVACVASVLSAPAQLCTAAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRR 96          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|768417791|ref|XP_011549552.1| (PREDICTED: myosuppressin-like [Plutella xylostella])

HSP 1 Score: 141.354 bits (355), Expect = 6.983e-42
Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 0
Query:   29 LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLD+GMKRQDVVHSFLRFGRRR
Sbjct:   32 LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRFGRRR 99          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|768440346|ref|XP_011561843.1| (PREDICTED: myosuppressin-like [Plutella xylostella])

HSP 1 Score: 140.969 bits (354), Expect = 8.941e-42
Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 0
Query:   29 LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLD+GMKRQDVVHSFLRFGRRR
Sbjct:   26 LCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRFGRRR 93          
BLAST of HiSeq13079 vs. genbank:protein
Match: gi|910326162|ref|XP_013166219.1| (PREDICTED: myosuppressin-like isoform X1 [Papilio xuthus])

HSP 1 Score: 135.961 bits (341), Expect = 9.305e-40
Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = 0
Query:   32 GAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR 96
            GAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLD+GMKRQDVVHSFLRFGRRR
Sbjct:   31 GAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRFGRRR 95          
The following BLAST results are available for this feature:
BLAST of HiSeq13079 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|946724954|gb|ALM30329.1|2.209e-5185.57myosuppressin precursor [Chilo suppressalis][more]
gi|15825168|gb|AAL09583.1|AF390443_18.042e-4784.62manducaFLRFamide I precursor [Mythimna unipuncta][more]
gi|1062563083|dbj|BAV57610.1|1.168e-4687.50myosuppressin [Mamestra brassicae][more]
gi|464897597|gb|AGH25562.1|2.183e-4681.72myosuppressin [Helicoverpa armigera][more]
gi|913310906|ref|XP_013186110.1|3.607e-4685.56PREDICTED: myosuppressin-like [Amyelois transitell... [more]
gi|166997946|emb|CAO86065.1|5.261e-4592.21myosuppressin precursor, partial [Spodoptera litto... [more]
gi|357605226|gb|EHJ64518.1|4.890e-4488.89manducaFLRFamide I precursor [Danaus plexippus][more]
gi|768417791|ref|XP_011549552.1|6.983e-4298.53PREDICTED: myosuppressin-like [Plutella xylostella... [more]
gi|768440346|ref|XP_011561843.1|8.941e-4298.53PREDICTED: myosuppressin-like [Plutella xylostella... [more]
gi|910326162|ref|XP_013166219.1|9.305e-4098.46PREDICTED: myosuppressin-like isoform X1 [Papilio ... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..24
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 25..96
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..8
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 20..24
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 9..19
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..25
score: 0.697
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.721
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..33
score: 0.703
NoneNo IPR availableTMHMMTMhelixcoord: 10..32

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13079HiSeq13079Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13079_p ID=HiSeq13079_p|Name=HiSeq13079|organism=Ostrinia scapulalis|type=polypeptide|length=96bp
MSRSIEYRAAVLVALACVVASAVCAPAPLCAGAAEDDPRAARFCQALNTF
LELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
back to top