HiSeq13081_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13081
Unique NameHiSeq13081_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length258
Homology
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|943943897|ref|XP_014355350.1| (PREDICTED: plexin A3-like [Papilio machaon])

HSP 1 Score: 229.565 bits (584), Expect = 1.498e-71
Identity = 100/216 (46.30%), Postives = 146/216 (67.59%), Query Frame = 0
Query:   44 PAGYCRSFRTCSECSRSMWYPCGWCHNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMNSLCPYIEHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSNKLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKC-SDLLKWNVNRLTCKSLGKKMLYV 258
            P  YCR F  C EC+    YPC WCH+ GC  + EK C    +  +L  +++  +M   CP+I H G IL+PA VR N++VK+ + DPV+YEKEI+C+++F  +  HLK +I+ ++V+CYPV L+   +G+   G++R++W GV P SN L + VY CE+LA DC+SCR IP EYGCGWC   NAC++ DKC ++ +KW +NRL+C +  +K+ YV
Sbjct:   62 PETYCRHFNNCIECTSGTLYPCSWCHDIGCVSETEKACKLRYST-NLSTNSSAQEMK--CPFISHSGPILLPADVRTNIKVKIFSPDPVIYEKEIVCEIKFKQKYIHLKGMIVKNIVHCYPVQLNVKRNGDIETGLLRILWDGVDPHSNVLPVVVYTCENLAQDCDSCRTIPPEYGCGWCDIYNACILGDKCINNFVKWALNRLSCDAFNRKLYYV 274          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|914576492|gb|KOB78359.1| (Plexin-A2 [Operophtera brumata])

HSP 1 Score: 188.734 bits (478), Expect = 4.708e-56
Identity = 93/201 (46.27%), Postives = 131/201 (65.17%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWCHNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMNSLCPYIEHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSNKLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C SFRTCSEC +S+  PC WCHN GCT+  +KLCPY    I L  SN        CPYI   G IL+ +G+R  + VKL+A DP++ +  IICQ++  +RV+HLK + +N+ VYC+P+ L+T    ET  G  RL WGGV P+SN++ ++V+ CE LA +CESC  I   + CGWC   ++CV+A++C+ +  W+ N  TC
Sbjct:   37 CSSFRTCSECVKSV--PCNWCHNLGCTNIGDKLCPYG---IALKKSNINKAKE--CPYIIP-GPILLASGIRTFIDVKLYAPDPIISDMNIICQIKLKNRVSHLKGVTINNSVYCHPIVLNT---KETLTGSFRLNWGGVDPYSNRVPVTVFNCEELAKNCESCITIDPVFRCGWCKSISSCVIANQCTGVTNWSGNNQTC 226          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|914576491|gb|KOB78358.1| (Plexin A [Operophtera brumata])

HSP 1 Score: 182.185 bits (461), Expect = 4.263e-52
Identity = 89/201 (44.28%), Postives = 131/201 (65.17%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWCHNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMNSLCPYIEHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSNKLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C SFRTCSEC +S+  PC WCHN GCT+  +KLCP+    I L  SN        CPYI     I+  +G+R  + VKL+A DP++Y+  I+CQ++  +RV+H + +I+++ VYC+PV L+T  + E  +G  RL WGGV+P+SN + ++V+ CE LA +CESC  I   + CGWC   ++CV+A+KC D+ KW+ +   C
Sbjct:  148 CNSFRTCSECVKSV--PCEWCHNLGCTNFGDKLCPHG---IALKYSNRNKAKE--CPYI-IPEPIIFASGIRTFINVKLYAPDPIIYDMNIMCQIKLKNRVSHFQGVIISNSVYCHPVMLNT--NREILLGSFRLNWGGVEPYSNGVPVTVFNCEELAKNCESCITIAPVFRCGWCKSISSCVIANKCKDVTKWSRDNQMC 338          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|943944085|ref|XP_014355426.1| (PREDICTED: plexin A3 [Papilio machaon] >gi|930677184|gb|KPJ17271.1| Plexin-A4 [Papilio machaon])

HSP 1 Score: 112.079 bits (279), Expect = 2.847e-24
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C   +    +     + +   S CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC PV                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C     W     TC
Sbjct:  631 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENCRNDILVTGISRIGPSYRSGPSFCPTINSTSDGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAKLLADTIYCEPVEFTYTSRAPNITASFAVIWGGSKPLDNPDDTHILIYRCSDMADNCGICLALPEKFGCGWCQGSDRCEVQEQCGAPSVWLNRTQTC 838          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|913299508|ref|XP_013196585.1| (PREDICTED: plexin-C1 isoform X1 [Amyelois transitella] >gi|913299511|ref|XP_013196593.1| PREDICTED: plexin-C1 isoform X2 [Amyelois transitella])

HSP 1 Score: 111.694 bits (278), Expect = 3.162e-24
Identity = 62/214 (28.97%), Postives = 101/214 (47.20%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMNS------LCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C     + D++ +  +    S       CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC PV                +IWGG +P  N   + I +YRC  +A +C  C  +P ++GCGWC   + C V ++C+    W     TC
Sbjct:  632 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENC-----RNDILVTGVSRIGPSYRSGPGFCPTINSTADGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAQLLADTIYCEPVEFTYTSRAPNITASFAVIWGGSKPLDNPDNMHILIYRCNDMADNCGMCLALPEKFGCGWCQGSDHCEVQEQCAIPSVWLNRTQTC 839          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|909568776|ref|XP_013139858.1| (PREDICTED: plexin-C1 [Papilio polytes])

HSP 1 Score: 111.694 bits (278), Expect = 3.193e-24
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C   +    +     + +   S CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC PV                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C     W     TC
Sbjct:  631 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENCRNDILVTGISRIGPSYRSGPSFCPTINSTSDGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAKLLADTIYCEPVEFTYTSRAPNITASFAVIWGGSKPLDNPDDTHILIYRCSDMADNCGICLALPEKFGCGWCQGSDRCEVQEQCGAPSVWLNRTQTC 838          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|910338451|ref|XP_013172828.1| (PREDICTED: plexin-C1 [Papilio xuthus])

HSP 1 Score: 111.694 bits (278), Expect = 3.580e-24
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C   +    +     + +   S CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC PV                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C     W     TC
Sbjct:  631 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENCRNDILVTGVSRIGPSYRSGPSFCPTINSTSDGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAKLLADTIYCEPVEFTYTSRAPNITASFAVIWGGSKPLDNPDDTHILIYRCSDMADNCGICLALPEKFGCGWCQGSDRCEVQEQCGAPSVWLNRTQTC 838          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|930663000|gb|KPJ04623.1| (Plexin-A4 [Papilio xuthus])

HSP 1 Score: 111.694 bits (278), Expect = 3.791e-24
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C   +    +     + +   S CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC PV                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C     W     TC
Sbjct:  631 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENCRNDILVTGVSRIGPSYRSGPSFCPTINSTSDGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAKLLADTIYCEPVEFTYTSRAPNITASFAVIWGGSKPLDNPDDTHILIYRCSDMADNCGICLALPEKFGCGWCQGSDRCEVQEQCGAPSVWLNRTQTC 838          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|512909073|ref|XP_004926833.1| (PREDICTED: plexin A3 [Bombyx mori])

HSP 1 Score: 109.383 bits (272), Expect = 2.193e-23
Identity = 60/209 (28.71%), Postives = 96/209 (45.93%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S  +PC WC     CT    + C   +    +     + +   S CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC  V                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C     W     TC
Sbjct:  632 CNTYSSCTQCVSSS-FPCDWCVDGHRCTHDTAENCRNDILVTGVSRIGPSYRSGPSFCPTINSTSDGTNEILVPSGVKKQIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAQLLADTIYCESVEFTYTSRAPNITASFAVIWGGSKPLDNPDNTHILIYRCNDMADNCGMCLALPEKFGCGWCQGSDRCEVQEQCGAPSVWLNRTQTC 839          
BLAST of HiSeq13081 vs. genbank:protein
Match: gi|768408694|ref|XP_011548758.1| (PREDICTED: plexin A3 [Plutella xylostella])

HSP 1 Score: 108.997 bits (271), Expect = 3.340e-23
Identity = 59/209 (28.23%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   48 CRSFRTCSECSRSMWYPCGWC-HNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN-SLCPYI----EHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTHLKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSN--KLQISVYRCESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTC 248
            C ++ +C++C  S+ +PC WC     CT    + C   +    +     + +     CP I    +    ILVP+GV++ ++VK+H     + +   +CQ     RVTH+ A ++ D +YC  V                +IWGG +P  N     I +YRC  +A +C  C  +P ++GCGWC   + C V ++C+    W     TC
Sbjct:  657 CNTYSSCTQCVSSL-FPCDWCVDGHRCTHDTAENCRNDILVTGVSRVGPSYRSGPGFCPTINSTSDGTNEILVPSGVKKAIKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNAQLLADTIYCEAVEFTYTSRAPNITASFAVIWGGSKPLDNPDNTHILIYRCNDMADNCGICLALPEKFGCGWCQGSDRCEVQEQCAVPSVWLNRTQTC 864          
The following BLAST results are available for this feature:
BLAST of HiSeq13081 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943943897|ref|XP_014355350.1|1.498e-7146.30PREDICTED: plexin A3-like [Papilio machaon][more]
gi|914576492|gb|KOB78359.1|4.708e-5646.27Plexin-A2 [Operophtera brumata][more]
gi|914576491|gb|KOB78358.1|4.263e-5244.28Plexin A [Operophtera brumata][more]
gi|943944085|ref|XP_014355426.1|2.847e-2429.19PREDICTED: plexin A3 [Papilio machaon] >gi|9306771... [more]
gi|913299508|ref|XP_013196585.1|3.162e-2428.97PREDICTED: plexin-C1 isoform X1 [Amyelois transite... [more]
gi|909568776|ref|XP_013139858.1|3.193e-2429.19PREDICTED: plexin-C1 [Papilio polytes][more]
gi|910338451|ref|XP_013172828.1|3.580e-2429.19PREDICTED: plexin-C1 [Papilio xuthus][more]
gi|930663000|gb|KPJ04623.1|3.791e-2429.19Plexin-A4 [Papilio xuthus][more]
gi|512909073|ref|XP_004926833.1|2.193e-2328.71PREDICTED: plexin A3 [Bombyx mori][more]
gi|768408694|ref|XP_011548758.1|3.340e-2328.23PREDICTED: plexin A3 [Plutella xylostella][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0071526 semaphorin-plexin signaling pathway
molecular_function GO:0017154 semaphorin receptor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016201Plexin-like foldSMARTSM00423PSIcoord: 47..104
e-value: 2.0
score: 13.0
coord: 200..249
e-value: 0.015
score: 24.5
IPR016201Plexin-like foldSUPERFAMILY103575Plexin repeatcoord: 201..239
NoneNo IPR availableGENE3D3.30.1680.10coord: 198..237
e-value: 3.2E-7
score: 29.8
NoneNo IPR availablePANTHERPTHR22625:SF16PLEXIN A, ISOFORM Acoord: 48..236
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 48..236

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13081HiSeq13081Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13081_p ID=HiSeq13081_p|Name=HiSeq13081|organism=Ostrinia scapulalis|type=polypeptide|length=258bp
MEFDDHSYSHFLSTDDKRKILGFLKSFTSAAKAQSRKPKLIEDPAGYCRS
FRTCSECSRSMWYPCGWCHNFGCTDKPEKLCPYAMTKIDLMDSNTTDKMN
SLCPYIEHVGSILVPAGVRQNVQVKLHASDPVLYEKEIICQLQFSDRVTH
LKALIMNDVVYCYPVTLDTIEHGETNIGIMRLIWGGVQPFSNKLQISVYR
CESLAVDCESCRLIPTEYGCGWCGEENACVVADKCSDLLKWNVNRLTCKS
LGKKMLYV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0071526semaphorin-plexin signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0017154semaphorin receptor activity
Vocabulary: INTERPRO
TermDefinition
IPR031148Plexin
IPR016201Plexin-like_fold