HiSeq13100_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13100
Unique NameHiSeq13100_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length541
Homology
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|913316838|ref|XP_013189375.1| (PREDICTED: forkhead box protein L2-like [Amyelois transitella])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 419/514 (81.52%), Postives = 457/514 (88.91%), Query Frame = 0
Query:   31 VANGADGASLHGDEE--VARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQVKSEEELSRVYQTLTLPPLPRDDTNS-NNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            +A  ADGA L GD E  V+RLT GL   F+MND+PL  Y VDTRRMQLY+HPH+H  ELSIHA+STHELLKPKDEP+YSLA + NLCSV+LHH+GT PYD RICLQ++   DT N  +K EE+LSRVYQTLTLP L RDD +S N+N NETKSK K  +PSSPG+SEMKPQSTT TSQALTKPPYSYVALITMAIQNSQ+KRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFR TPYSK LFGDGYHVAHVAQHVPPHMQPLPLGARNYFGS SPYPPSYPRYDT WLTQS SGLGY+  CG MGRSPPGCSPHSAMPHQSSPV+VNPFA HQLQGQLQN+LQPMQ++PMNSYN +GVT+L+GS SPGPGYAPSSGG+SP+RHHD+VTSSD AVSRF FWPEGGSPSPN GYVP+S+FSP RRHE  +S  + G+R++FWPDVGVKEEASSSLVSNGPPYSK FM
Sbjct:    1 MAGSADGAGLDGDCEDNVSRLT-GLPEPFDMNDIPLGNYAVDTRRMQLYAHPHIHAAELSIHAVSTHELLKPKDEPAYSLAATTNLCSVNLHHAGTSPYDSRICLQESN--DTSNPGIKGEEDLSRVYQTLTLPSLSRDDNSSTNSNGNETKSKVKA-SPSSPGSSEMKPQSTTSTSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRTTPYSKALFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSTSPYPPSYPRYDTAWLTQSTSGLGYASTCGAMGRSPPGCSPHSAMPHQSSPVAVNPFAPHQLQGQLQNSLQPMQSLPMNSYNSLGVTALDGSPSPGPGYAPSSGGYSPSRHHDVVTSSDTAVSRFSFWPEGGSPSPNAGYVPSSSFSPPRRHEVTSSDAAAGARFTFWPDVGVKEEASSSLVSNGPPYSKYFM 510          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|943969768|ref|XP_014366631.1| (PREDICTED: forkhead box protein L2-like isoform X4 [Papilio machaon])

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 391/516 (75.78%), Postives = 435/516 (84.30%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPG--NSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            VA  ADGA LH   +E+V RL P LQ SFEMNDLP   Y  DTRRMQLYSH H+HPTELSIHA+STHELLKPKDEPSYSLAPS NLC+  + H+G+ PYD+R C+Q+N   +  NSQ VKS+EELSRVYQTLT+P L RDDT +N+NS++TK K+K   PSSPG  ++E+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPL ARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS S         G FSPTRHHDIVTSSD   +RF FWPE GSPSPN GYVP+S++SPTRRHE VTSS++ G R+SFWPDVGVKEEASSSL+SNG PYSKCFM
Sbjct:   10 VARSADGAGLHRASEEDVVRLNPCLQTSFEMNDLPPTAYPTDTRRMQLYSHAHIHPTELSIHAVSTHELLKPKDEPSYSLAPSANLCTGGMQHTGSSPYDNRTCIQENNGVNANNSQSVKSDEELSRVYQTLTMPGLSRDDT-ANSNSSDTKIKSKSTTPSSPGGNSTEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLSARNYFGSSSPYPPSYPRYDTTWLTQPPGGLNYASACGGMGRSPPSSS-HTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPS-PGPGYGPPGAFSPTRHHDIVTSSDGTAARFSFWPEAGSPSPNAGYVPSSSYSPTRRHEVVTSSETAG-RFSFWPDVGVKEEASSSLMSNGAPYSKCFM 518          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|827554844|ref|XP_012548957.1| (PREDICTED: forkhead box protein L2-like isoform X2 [Bombyx mori])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 369/486 (75.93%), Postives = 413/486 (84.98%), Query Frame = 0
Query:   59 MNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQVKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPY-PPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIP-MNSYNPIGVTSLEGSSSPGPGYAPSS-GGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            MN+LP N Y++DTRRMQLYSH H+HP ELSIHA+S +ELLKPKDEP+YSLA S N CS+ LHH+ T PYD+RIC+  N   +      K +E+LSRVYQTL+LP LP  +  S NNS ++KSK K   PSSPGNSE+K Q+T+  SQALTKPPYSYVALITMAIQNSQ+KRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCG+MFENGNFRRRRRMKRPFRA PYSK LFGDGYHV+HVAQHVPPHMQPLPLG RNYFGSGSPY PPSYPRYD TWL+QS  GLGY    G M RSPPGCSPHSA+PHQ+  V+V+PFA+HQLQGQ  ++LQPMQ++  +NSYNPIGVTS++G  SPGP YA  S G FSP+RHHDIVTSSD  V R PFWPEGGS SPN GYVP+SNFSP RRHEAVTSSD+ G+R+SFWPDVGVKEEASSSL+SN  PYSKCFM
Sbjct:    1 MNELPTNAYSLDTRRMQLYSHQHIHPAELSIHAVSANELLKPKDEPNYSLAASSNNCSI-LHHTVTSPYDNRICMDTNTNENHNAQNSKGDEDLSRVYQTLSLPTLPSREETSPNNSEDSKSKIKTMTPSSPGNSEIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNFRRRRRMKRPFRANPYSKALFGDGYHVSHVAQHVPPHMQPLPLGPRNYFGSGSPYHPPSYPRYDATWLSQSAGGLGY----GSMARSPPGCSPHSALPHQAPSVAVSPFATHQLQGQFPSSLQPMQSMSHVNSYNPIGVTSIDGPPSPGPAYANCSVGDFSPSRHHDIVTSSDTPV-RLPFWPEGGSSSPNHGYVPSSNFSPPRRHEAVTSSDTAGARFSFWPDVGVKEEASSSLLSNAAPYSKCFM 480          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|943969758|ref|XP_014366627.1| (PREDICTED: forkhead box protein L2-like isoform X1 [Papilio machaon] >gi|943969761|ref|XP_014366628.1| PREDICTED: forkhead box protein L2-like isoform X1 [Papilio machaon])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 392/539 (72.73%), Postives = 436/539 (80.89%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPG--NSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEG-----------------------GSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            VA  ADGA LH   +E+V RL P LQ SFEMNDLP   Y  DTRRMQLYSH H+HPTELSIHA+STHELLKPKDEPSYSLAPS NLC+  + H+G+ PYD+R C+Q+N   +  NSQ VKS+EELSRVYQTLT+P L RDDT +N+NS++TK K+K   PSSPG  ++E+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPL ARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS S         G FSPTRHHDIVTSSD   +RF FWPEG                       GSPSPN GYVP+S++SPTRRHE VTSS++ G R+SFWPDVGVKEEASSSL+SNG PYSKCFM
Sbjct:   10 VARSADGAGLHRASEEDVVRLNPCLQTSFEMNDLPPTAYPTDTRRMQLYSHAHIHPTELSIHAVSTHELLKPKDEPSYSLAPSANLCTGGMQHTGSSPYDNRTCIQENNGVNANNSQSVKSDEELSRVYQTLTMPGLSRDDT-ANSNSSDTKIKSKSTTPSSPGGNSTEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLSARNYFGSSSPYPPSYPRYDTTWLTQPPGGLNYASACGGMGRSPPSSS-HTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPS-PGPGYGPPGAFSPTRHHDIVTSSDGTAARFSFWPEGGLSWQQPGCEIPDDVPREPEEDAGSPSPNAGYVPSSSYSPTRRHEVVTSSETAG-RFSFWPDVGVKEEASSSLMSNGAPYSKCFM 541          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|943969766|ref|XP_014366630.1| (PREDICTED: forkhead box protein L2-like isoform X3 [Papilio machaon])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 391/539 (72.54%), Postives = 436/539 (80.89%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPG--NSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEG-----------------------GSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            +A  ADGA LH   +E+V RL P LQ SFEMNDLP   Y  DTRRMQLYSH H+HPTELSIHA+STHELLKPKDEPSYSLAPS NLC+  + H+G+ PYD+R C+Q+N   +  NSQ VKS+EELSRVYQTLT+P L RDDT +N+NS++TK K+K   PSSPG  ++E+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPL ARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS S         G FSPTRHHDIVTSSD   +RF FWPEG                       GSPSPN GYVP+S++SPTRRHE VTSS++ G R+SFWPDVGVKEEASSSL+SNG PYSKCFM
Sbjct:    1 MARSADGAGLHRASEEDVVRLNPCLQTSFEMNDLPPTAYPTDTRRMQLYSHAHIHPTELSIHAVSTHELLKPKDEPSYSLAPSANLCTGGMQHTGSSPYDNRTCIQENNGVNANNSQSVKSDEELSRVYQTLTMPGLSRDDT-ANSNSSDTKIKSKSTTPSSPGGNSTEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLSARNYFGSSSPYPPSYPRYDTTWLTQPPGGLNYASACGGMGRSPPSSS-HTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPS-PGPGYGPPGAFSPTRHHDIVTSSDGTAARFSFWPEGGLSWQQPGCEIPDDVPREPEEDAGSPSPNAGYVPSSSYSPTRRHEVVTSSETAG-RFSFWPDVGVKEEASSSLMSNGAPYSKCFM 532          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|512921747|ref|XP_004929950.1| (PREDICTED: forkhead box protein L2-like isoform X1 [Bombyx mori])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 368/488 (75.41%), Postives = 413/488 (84.63%), Query Frame = 0
Query:   59 MNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQVKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPY-PPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIP-MNSYNPIGVTSLEGSSSPGPGYAPSS-GGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWP--DVGVKEEASSSLVSNGPPYSKCFM 541
            MN+LP N Y++DTRRMQLYSH H+HP ELSIHA+S +ELLKPKDEP+YSLA S N CS+ LHH+ T PYD+RIC+  N   +      K +E+LSRVYQTL+LP LP  +  S NNS ++KSK K   PSSPGNSE+K Q+T+  SQALTKPPYSYVALITMAIQNSQ+KRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCG+MFENGNFRRRRRMKRPFRA PYSK LFGDGYHV+HVAQHVPPHMQPLPLG RNYFGSGSPY PPSYPRYD TWL+QS  GLGY    G M RSPPGCSPHSA+PHQ+  V+V+PFA+HQLQGQ  ++LQPMQ++  +NSYNPIGVTS++G  SPGP YA  S G FSP+RHHDIVTSSD  V R PFWPEGGS SPN GYVP+SNFSP RRHEAVTSSD+ G+R+SFWP  D+GVKEEASSSL+SN  PYSKCFM
Sbjct:    1 MNELPTNAYSLDTRRMQLYSHQHIHPAELSIHAVSANELLKPKDEPNYSLAASSNNCSI-LHHTVTSPYDNRICMDTNTNENHNAQNSKGDEDLSRVYQTLSLPTLPSREETSPNNSEDSKSKIKTMTPSSPGNSEIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNFRRRRRMKRPFRANPYSKALFGDGYHVSHVAQHVPPHMQPLPLGPRNYFGSGSPYHPPSYPRYDATWLSQSAGGLGY----GSMARSPPGCSPHSALPHQAPSVAVSPFATHQLQGQFPSSLQPMQSMSHVNSYNPIGVTSIDGPPSPGPAYANCSVGDFSPSRHHDIVTSSDTPV-RLPFWPEGGSSSPNHGYVPSSNFSPPRRHEAVTSSDTAGARFSFWPDGDLGVKEEASSSLLSNAAPYSKCFM 482          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|943969763|ref|XP_014366629.1| (PREDICTED: forkhead box protein L2-like isoform X2 [Papilio machaon])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 392/539 (72.73%), Postives = 435/539 (80.71%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPG--NSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEG-----------------------GSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            VA  ADGA LH   +E+V RL P LQ SFEMNDLP   Y  DTRRMQLYSH H+HPTELSIHA+STHELLKPKDEPSYSLAPS NLC+  + H+G+ PYD+R C+Q+N   +  NSQ VKS+EELSRVYQTLT+P L RDDT +N+NS +TK K+K   PSSPG  ++E+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPL ARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS S         G FSPTRHHDIVTSSD   +RF FWPEG                       GSPSPN GYVP+S++SPTRRHE VTSS++ G R+SFWPDVGVKEEASSSL+SNG PYSKCFM
Sbjct:   10 VARSADGAGLHRASEEDVVRLNPCLQTSFEMNDLPPTAYPTDTRRMQLYSHAHIHPTELSIHAVSTHELLKPKDEPSYSLAPSANLCTGGMQHTGSSPYDNRTCIQENNGVNANNSQSVKSDEELSRVYQTLTMPGLSRDDT-ANSNS-DTKIKSKSTTPSSPGGNSTEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLSARNYFGSSSPYPPSYPRYDTTWLTQPPGGLNYASACGGMGRSPPSSS-HTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPS-PGPGYGPPGAFSPTRHHDIVTSSDGTAARFSFWPEGGLSWQQPGCEIPDDVPREPEEDAGSPSPNAGYVPSSSYSPTRRHEVVTSSETAG-RFSFWPDVGVKEEASSSLMSNGAPYSKCFM 540          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|909581076|ref|XP_013146511.1| (PREDICTED: forkhead box protein D2-like isoform X2 [Papilio polytes])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 389/559 (69.59%), Postives = 438/559 (78.35%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPT----------------------ELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEG-----------------------GSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            +A  ADGA LH   DE+V RL P LQ +FEMNDLP   YT DTRRMQLYSH H+HPT                      ELSIHA+STHELLKPKDEPSYSLAPS +LC+  L  +G+ PYD+R C+Q+N   +  +SQ VKS+E+LSRVYQTLT+P L RDDT ++N+  + KSK+  P+     +SE+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPLGARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS SPGPGY P  G FSPTRHHDIVTSSD A +RF FW EG                       GSPSPN GYVP+S++SPTRRHEAVTSS++ G R++FWPDVGVKEE+SSSL+SNG PYSKCFM
Sbjct:    1 MARSADGAGLHRASDEDVVRLNPCLQTNFEMNDLPPTAYTTDTRRMQLYSHAHIHPTAYTSGVWDTNHSNQTDSSEHGQELSIHAVSTHELLKPKDEPSYSLAPSASLCTGGLQLTGSSPYDNRTCIQENNGVNASSSQSVKSDEDLSRVYQTLTMPGLSRDDTTNSNSETKIKSKSTTPSSPGGSSSEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLGARNYFGSSSPYPPSYPRYDTTWLTQPPGGLSYASACGGMGRSPP-SSTHTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPSPGPGYVP-PGAFSPTRHHDIVTSSDGAAARFSFWQEGGLSWQQPGCEIPDDVPREPEDDAGSPSPNGGYVPSSSYSPTRRHEAVTSSEAAG-RFAFWPDVGVKEESSSSLMSNGAPYSKCFM 553          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|909581074|ref|XP_013146510.1| (PREDICTED: forkhead box protein D2-like isoform X1 [Papilio polytes])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 391/560 (69.82%), Postives = 439/560 (78.39%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPT----------------------ELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQ-VKSEEELSRVYQTLTLPPLPRDDT-NSNNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEG-----------------------GSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM 541
            +A  ADGA LH   DE+V RL P LQ +FEMNDLP   YT DTRRMQLYSH H+HPT                      ELSIHA+STHELLKPKDEPSYSLAPS +LC+  L  +G+ PYD+R C+Q+N   +  +SQ VKS+E+LSRVYQTLT+P L RDDT NSN++  + KSK+  P+     +SE+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPLGARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQN LQPMQ++ MN+YN IGV  L+GS SPGPGY P  G FSPTRHHDIVTSSD A +RF FW EG                       GSPSPN GYVP+S++SPTRRHEAVTSS++ G R++FWPDVGVKEE+SSSL+SNG PYSKCFM
Sbjct:    1 MARSADGAGLHRASDEDVVRLNPCLQTNFEMNDLPPTAYTTDTRRMQLYSHAHIHPTAYTSGVWDTNHSNQTDSSEHGQELSIHAVSTHELLKPKDEPSYSLAPSASLCTGGLQLTGSSPYDNRTCIQENNGVNASSSQSVKSDEDLSRVYQTLTMPGLSRDDTTNSNSSETKIKSKSTTPSSPGGSSSEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLGARNYFGSSSPYPPSYPRYDTTWLTQPPGGLSYASACGGMGRSPPS-STHTSLPHQPSPVSVNPFASHQLQGQLQNPLQPMQSMSMNTYNQIGV-GLDGSPSPGPGYVP-PGAFSPTRHHDIVTSSDGAAARFSFWQEGGLSWQQPGCEIPDDVPREPEDDAGSPSPNGGYVPSSSYSPTRRHEAVTSSEAAG-RFAFWPDVGVKEESSSSLMSNGAPYSKCFM 554          
BLAST of HiSeq13100 vs. genbank:protein
Match: gi|910350908|ref|XP_013179359.1| (PREDICTED: forkhead box protein L2-like isoform X5 [Papilio xuthus])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 383/521 (73.51%), Postives = 431/521 (82.73%), Query Frame = 0
Query:   31 VANGADGASLH--GDEEVARLTPGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKPKDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQVKSEEELSRVYQTLTLPPLPRDDT-NSNNNSNETKSKAKPPAPSSPGNSEMKPQSTTPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRRRRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGSPYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPVSVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPSSGGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRHEAVTSSDSPGSRYSFWPD-------VGVKEEASSSLVSNGPPYSKCFM 541
            VA  ADGA LH   +E+V RL P LQ +FEMNDLP + Y  DTRRMQLYSH H+HPTELSIHA+STHELLKPKDEPSYSLAPS NLC+  + H+ +  YD R C+Q+N   +  +  VK +EELSRVYQTLT+P L RDDT NSN++ ++ KSK   P+     +SE+KPQSTTPTSQALTKPP+SYVALITMAI+NSQSKRATLSEIYAYITKEFP+FEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC  MFE GN++RRRRMKRPFRATPY+KTLFGDGYHV HVAQH   HMQ LPL ARNYFGS SPYPPSYPRYDTTWLTQ P GL Y+ ACGGMGRSPP  S H+++PHQ SPVSVNPFASHQLQGQLQ+ LQPMQ++ MN+YN IGV  L+GS SPGPG     G FSPTRHHDIVTSSD A +RF FWPE GSPSPN GYVP+S++SPTRRHEAVTSS++ G R++FWPD       VGVKEE+SSSL+SNG PYSKCFM
Sbjct:   10 VARSADGAGLHRASEEDVVRLNPCLQTNFEMNDLPPSAYPTDTRRMQLYSHAHIHPTELSIHAVSTHELLKPKDEPSYSLAPSANLCTGGMQHTVSSAYDTRTCIQENNGVNASSQSVKPDEELSRVYQTLTMPGLSRDDTANSNSSDSKIKSKPTTPSSPGGSSSEIKPQSTTPTSQALTKPPFSYVALITMAIENSQSKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCRGMFEGGNYKRRRRMKRPFRATPYTKTLFGDGYHVTHVAQHA--HMQSLPLSARNYFGSSSPYPPSYPRYDTTWLTQPPGGLNYASACGGMGRSPPS-STHTSLPHQPSPVSVNPFASHQLQGQLQSPLQPMQSMSMNTYNQIGV-GLDGSPSPGPG-YGPPGAFSPTRHHDIVTSSDGAAARFSFWPEAGSPSPNAGYVPSSSYSPTRRHEAVTSSEAAG-RFAFWPDGNNLNFNVGVKEESSSSLMSNGAPYSKCFM 524          
The following BLAST results are available for this feature:
BLAST of HiSeq13100 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913316838|ref|XP_013189375.1|0.000e+081.52PREDICTED: forkhead box protein L2-like [Amyelois ... [more]
gi|943969768|ref|XP_014366631.1|0.000e+075.78PREDICTED: forkhead box protein L2-like isoform X4... [more]
gi|827554844|ref|XP_012548957.1|0.000e+075.93PREDICTED: forkhead box protein L2-like isoform X2... [more]
gi|943969758|ref|XP_014366627.1|0.000e+072.73PREDICTED: forkhead box protein L2-like isoform X1... [more]
gi|943969766|ref|XP_014366630.1|0.000e+072.54PREDICTED: forkhead box protein L2-like isoform X3... [more]
gi|512921747|ref|XP_004929950.1|0.000e+075.41PREDICTED: forkhead box protein L2-like isoform X1... [more]
gi|943969763|ref|XP_014366629.1|0.000e+072.73PREDICTED: forkhead box protein L2-like isoform X2... [more]
gi|909581076|ref|XP_013146511.1|0.000e+069.59PREDICTED: forkhead box protein D2-like isoform X2... [more]
gi|909581074|ref|XP_013146510.1|0.000e+069.82PREDICTED: forkhead box protein D2-like isoform X1... [more]
gi|910350908|ref|XP_013179359.1|0.000e+073.51PREDICTED: forkhead box protein L2-like isoform X5... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Transcription factor, fork headPRINTSPR00053FORKHEADcoord: 253..270
score: 79.54
coord: 230..247
score: 46.83
coord: 209..222
score: 75.4
IPR001766Transcription factor, fork headSMARTSM00339FHcoord: 207..297
e-value: 1.7E-57
score: 207.0
IPR001766Transcription factor, fork headPFAMPF00250Fork_headcoord: 209..303
e-value: 3.9E-40
score: 135.6
IPR001766Transcription factor, fork headPROSITEPS50039FORK_HEAD_3coord: 209..303
score: 38.352
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 197..296
e-value: 1.3E-41
score: 140.2
NoneNo IPR availablePANTHERPTHR11829:SF105FORKHEAD BOX PROTEIN L2coord: 205..318
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 205..318
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 134..154
NoneNo IPR availablePANTHERPTHR11829:SF105FORKHEAD BOX PROTEIN L2coord: 134..154
NoneNo IPR availablePROSITEPS00658FORK_HEAD_2coord: 253..259
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 208..303
IPR018122Fork head domain conserved site1PROSITEPS00657FORK_HEAD_1coord: 209..222

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13100HiSeq13100Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13100_p ID=HiSeq13100_p|Name=HiSeq13100|organism=Ostrinia scapulalis|type=polypeptide|length=541bp
MXLGFPESFKRKLLRGEKDSSAXDFTDLKVVANGADGASLHGDEEVARLT
PGLQRSFEMNDLPLNTYTVDTRRMQLYSHPHVHPTELSIHAMSTHELLKP
KDEPSYSLAPSGNLCSVSLHHSGTPPYDHRICLQDNGEADTPNSQVKSEE
ELSRVYQTLTLPPLPRDDTNSNNNSNETKSKAKPPAPSSPGNSEMKPQST
TPTSQALTKPPYSYVALITMAIQNSQSKRATLSEIYAYITKEFPYFEKNK
KGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGDMFENGNFRR
RRRMKRPFRATPYSKTLFGDGYHVAHVAQHVPPHMQPLPLGARNYFGSGS
PYPPSYPRYDTTWLTQSPSGLGYSGACGGMGRSPPGCSPHSAMPHQSSPV
SVNPFASHQLQGQLQNTLQPMQTIPMNSYNPIGVTSLEGSSSPGPGYAPS
SGGFSPTRHHDIVTSSDAAVSRFPFWPEGGSPSPNTGYVPASNFSPTRRH
EAVTSSDSPGSRYSFWPDVGVKEEASSSLVSNGPPYSKCFM
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR018122TF_fork_head_CS_1
IPR011991WHTH_DNA-bd_dom
IPR001766TF_fork_head