HiSeq13103_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13103
Unique NameHiSeq13103_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length324
Homology
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|357613737|gb|EHJ68696.1| (receptor protein-tyrosine phosphatase 10d [Danaus plexippus])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 285/312 (91.35%), Postives = 296/312 (94.87%), Query Frame = 0
Query:    1 PPPPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFE 312
            P   PAP+ SRPVRV+DFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVT+LNESR+PDWT+TEL VCRG+EQRV+ HFHFTTWPDFGVPDPPT LARFVRAFRERCPAD RPVVVHCSAGVGRSGTFITLDRALQQLAAHAD LD+FGMVHAMRRERVWMVQTEQQYICIHQC+VA LEG DL PP   P++HH NPAFE
Sbjct: 1279 PTAVPAPQASRPVRVSDFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTSLNESRFPDWTVTELAVCRGAEQRVVTHFHFTTWPDFGVPDPPTALARFVRAFRERCPADGRPVVVHCSAGVGRSGTFITLDRALQQLAAHADTLDIFGMVHAMRRERVWMVQTEQQYICIHQCVVAALEGADLAPPSPPPNNHHLNPAFE 1590          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|913311311|ref|XP_013186327.1| (PREDICTED: tyrosine-protein phosphatase 99A [Amyelois transitella])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 271/287 (94.43%), Postives = 278/287 (96.86%), Query Frame = 0
Query:   13 VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCP--ADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQP 297
            VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRM WESGSRAIVMLTRC EKGREKCDRYWPYDTRPVYYGDIAVT+LNESR+PDWTITELMVCRG+EQRV+KHFHFTTWPDFGVPDPPTTLARFV +FRERCP  AD RPVVVHCSAGVGRSGTFITLDRALQQLAA AD LD+FGMVHAMRRERVWMVQTEQQYICIHQC+VAVLEGQDL P
Sbjct:  311 VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMVWESGSRAIVMLTRCQEKGREKCDRYWPYDTRPVYYGDIAVTSLNESRFPDWTITELMVCRGNEQRVVKHFHFTTWPDFGVPDPPTTLARFVMSFRERCPARADCRPVVVHCSAGVGRSGTFITLDRALQQLAARADELDIFGMVHAMRRERVWMVQTEQQYICIHQCVVAVLEGQDLAP 597          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|913312142|ref|XP_013186783.1| (PREDICTED: tyrosine-protein phosphatase 10D [Amyelois transitella])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 271/287 (94.43%), Postives = 278/287 (96.86%), Query Frame = 0
Query:   13 VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCP--ADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQP 297
            VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRM WESGSRAIVMLTRC EKGREKCDRYWPYDTRPVYYGDIAVT+LNESR+PDWTITELMVCRG+EQRV+KHFHFTTWPDFGVPDPPTTLARFV +FRERCP  AD RPVVVHCSAGVGRSGTFITLDRALQQLAA AD LD+FGMVHAMRRERVWMVQTEQQYICIHQC+VAVLEGQDL P
Sbjct: 1265 VRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMVWESGSRAIVMLTRCQEKGREKCDRYWPYDTRPVYYGDIAVTSLNESRFPDWTITELMVCRGNEQRVVKHFHFTTWPDFGVPDPPTTLARFVMSFRERCPARADCRPVVVHCSAGVGRSGTFITLDRALQQLAARADELDIFGMVHAMRRERVWMVQTEQQYICIHQCVVAVLEGQDLAP 1551          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|952513800|gb|KRT80321.1| (hypothetical protein AMK59_8445, partial [Oryctes borbonicus])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 242/318 (76.10%), Postives = 273/318 (85.85%), Query Frame = 0
Query:    3 PPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGERERAAA 320
            P     T+RP+R+ +F +HYR+MSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLH TRDDFWRMCWES SRAI+MLTRCVEKGREKCD YWPYDT PVYYGDI+V  LNE+RYPDW I+E MVCRG  QRV++HFHFTTWPDFGVP+PP TL RFVRAFRE+   D RP+VVHCSAGVGRSGTFI LDR +QQ++  +D +D+FG+V+AMR+ERVWMVQTEQQYICIHQCL+ VLEG++L     +P   H N  FE +   A +
Sbjct:  374 PDSVIETNRPIRIENFSNHYRVMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIIMLTRCVEKGREKCDHYWPYDTMPVYYGDISVQILNETRYPDWNISEFMVCRGDTQRVIRHFHFTTWPDFGVPNPPHTLVRFVRAFREKVAPDQRPIVVHCSAGVGRSGTFICLDRIIQQISV-SDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCLLTVLEGKELT---GSPREIHENQGFEDDEGIAES 687          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|732597597|gb|JAG14222.1| (Tyrosine-protein phosphatase 10D [Lygus hesperus])

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 242/310 (78.06%), Postives = 268/310 (86.45%), Query Frame = 0
Query:    6 APRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGER 315
            A  TSRP+ +A+F DHYR+MSADSDFRFSEEFEELK VGREQ  + ADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPG NSPREFIVTQGPLH TRDDFWRMCWES SRAIVMLTRC+EKGREKCD YWPYDT PVYYGDI+VT LNESRYPDWT++E ++ RG  QRV++HFHFTTWPDFGVP+PPTTL RFVRAFRER   + RP+VVHCSAGVGRSGTFI LDR LQ L   AD +D+FG+V  MR+ERVWMVQTEQQYICI+QCL+AVLEG+D Q P   P   HHN  FEG++
Sbjct:  335 AMETSRPIPLANFADHYRIMSADSDFRFSEEFEELKMVGREQSNSFADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGWNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCIEKGREKCDHYWPYDTMPVYYGDISVTTLNESRYPDWTVSEFIMARGDTQRVIRHFHFTTWPDFGVPNPPTTLVRFVRAFRERIAPEQRPIVVHCSAGVGRSGTFIALDRILQSLNHGADTVDIFGIVWGMRKERVWMVQTEQQYICIYQCLLAVLEGEDNQAP---PREIHHNQGFEGKK 641          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|1080072043|ref|XP_018578511.1| (PREDICTED: tyrosine-protein phosphatase 10D-like, partial [Anoplophora glabripennis])

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 243/318 (76.42%), Postives = 270/318 (84.91%), Query Frame = 0
Query:    3 PPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGERERAAA 320
            P     TSRPVR+ +F +HYR+MSADSDFRFSEEFEELKHVGR+QPCT ADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPG+NSPREF+VTQGPLH TRDDFWRM WES SRAI+MLTRCVEKGREKCD YWPYDT P YYGDI+V  LNESRYPDW I+E MVCRG +QRV++HFHFTTWPDFGVP+PP TL RFVRAFRER P D RP+VVHCSAGVGRSGTFI LDR LQQ+    D +D+FG+V+AMR+ERVWMVQTEQQYICIHQCL+AVLEG+DL     +    H N  FE +   A +
Sbjct:   49 PDSVIETSRPVRIENFSNHYRIMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGYNSPREFLVTQGPLHSTRDDFWRMVWESNSRAIIMLTRCVEKGREKCDHYWPYDTMPAYYGDISVQILNESRYPDWNISEFMVCRGEQQRVVRHFHFTTWPDFGVPNPPHTLVRFVRAFRERVPPDQRPIVVHCSAGVGRSGTFICLDRILQQILV-CDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKDLS---GSSREIHENQGFEDDEGIAES 362          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|732576351|gb|JAG03599.1| (Tyrosine-protein phosphatase 10D [Lygus hesperus])

HSP 1 Score: 521.931 bits (1343), Expect = 3.944e-180
Identity = 242/315 (76.83%), Postives = 268/315 (85.08%), Query Frame = 0
Query:    6 APRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGERERAAA 320
            A  TSRP+ +A+F DHYR+MSADSDFRFSEEFEELK VGREQ  + ADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPG NSPREFIVTQGPLH TRDDFWRMCWES SRAIVMLTRC+EKGREKCD YWPYDT PVYYGDI+VT LNESRYPDWT++E ++ RG  QRV++HFHFTTWPDFGVP+PPTTL RFVRAFRER   + RP+VVHCSAGVGRSGTFI LDR LQ L   AD +D+FG+V  MR+ERVWMVQTEQQYICI+QCL+AVLEG+D Q P   P   HHN  FE +   A +
Sbjct:  335 AMETSRPIPLANFADHYRIMSADSDFRFSEEFEELKMVGREQSNSFADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGWNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCIEKGREKCDHYWPYDTMPVYYGDISVTTLNESRYPDWTVSEFIMARGDTQRVIRHFHFTTWPDFGVPNPPTTLVRFVRAFRERIAPEQRPIVVHCSAGVGRSGTFIALDRILQSLNHGADTVDIFGIVWGMRKERVWMVQTEQQYICIYQCLLAVLEGEDNQAP---PREIHHNQGFEDDEGIAES 646          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|1058244814|gb|JAT25902.1| (hypothetical protein g.34951, partial [Graphocephala atropunctata])

HSP 1 Score: 518.079 bits (1333), Expect = 5.366e-180
Identity = 240/322 (74.53%), Postives = 270/322 (83.85%), Query Frame = 0
Query:    3 PPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGERERAAAPDAP 324
            P     TSRPV +  F +HYRLMSADSDFRFSEEFEELKHVGR+QPCTAADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPG+NSPREFIVTQGPLH TRDDFWRMCWES SRAI+MLTRC+EKGREKCD YWPYDT  V+YGDI+VT LNE  YPDW+ITE+++CRG + RV++HFHFTTWPDFGVP+PP TL RFVRAFRE+ P D RP+VVHCSAGVGRSGT I LDR LQQL   +D +D++G+V  MR+ERVWMVQTEQQYICIHQCL+AVLEG +    + N    HHN  FEG+R+       P
Sbjct:  236 PDSIIETSRPVHLEKFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGYNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIIMLTRCIEKGREKCDHYWPYDTLRVFYGDISVTILNECHYPDWSITEMVMCRGEQNRVIRHFHFTTWPDFGVPNPPQTLVRFVRAFREKVPGDQRPIVVHCSAGVGRSGTLIALDRILQQLHT-SDVVDIYGIVWQMRKERVWMVQTEQQYICIHQCLLAVLEGNE---GNGNTREIHHNQGFEGKRKSEVLEKLP 553          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|355333041|pdb|3S3E|A (Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster >gi|355333042|pdb|3S3E|B Chain B, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster >gi|355333043|pdb|3S3F|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Small Molecule Inhibitor Vanadate >gi|355333044|pdb|3S3F|B Chain B, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Small Molecule Inhibitor Vanadate >gi|355333045|pdb|3S3H|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Phosphopeptide Substrate Gp4 >gi|355333046|pdb|3S3H|B Chain B, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Phosphopeptide Substrate Gp4 >gi|355333048|pdb|3S3K|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Small Molecular Inhibitor Para-nitrocatechol Sulphate >gi|355333049|pdb|3S3K|B Chain B, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster With A Small Molecular Inhibitor Para-nitrocatechol Sulphate)

HSP 1 Score: 504.212 bits (1297), Expect = 2.558e-178
Identity = 232/292 (79.45%), Postives = 261/292 (89.38%), Query Frame = 0
Query:    3 PPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQD 294
            P  +   SRP+ + +F +HYRLMSADSDFRFSEEFEELKHVGR+QPCT ADLPCNRPKNRFTNILPYDHSR+KLQPVDD+EGSDYINANYVPGHNSPREFIVTQGPLH TRDDFWRMCWES SRAIVMLTRC EKGREKCD+YWP DT PV+YGDI V  LN+S Y DW +TE M+CRGSEQR+L+HFHFTTWPDFGVP+PP TL RFVRAFR+R  A+ RP+VVHCSAGVGRSGTFITLDR LQQ+   +D +D+FG+V+AMR+ERVWMVQTEQQYICIHQCL+AVLEG++
Sbjct:   16 PRGSHMASRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCLLAVLEGKE 306          
BLAST of HiSeq13103 vs. genbank:protein
Match: gi|1058093914|gb|JAS50616.1| (hypothetical protein g.40819, partial [Cuerna arida])

HSP 1 Score: 510.76 bits (1314), Expect = 2.747e-178
Identity = 237/318 (74.53%), Postives = 267/318 (83.96%), Query Frame = 0
Query:    3 PPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCTAADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPREFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDTRPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGVPDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLAAHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHHNPHHHHHNPAFEGERERAAA 320
            P     TSRPV +  F +HYRLMSADSDFRFSEEFEELKHVGR+QPCTAADLPCNRPKNRFTNILPYDHSR+KLQPVDDEEGSDYINANYVPG+NSPREFIVTQGPLH TRDDFWRMCWES SRAI+MLTRC+EKGREKCD YWPYDT  V+YGDIAVT LNE  YPDW+ITE+++CRG + RV++HFHFTTWPDFGVP+PP TL RFVRAFR++ P D RP+VVHCSAGVGRSGT I LDR LQQL   +D +D++G+V  MR+ERVWMVQTE QYICIHQCL+AVLEG +    + N    HHN  FE +   A +
Sbjct:  156 PDSIIETSRPVHLEKFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTAADLPCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANYVPGYNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIIMLTRCIEKGREKCDHYWPYDTLRVFYGDIAVTILNECHYPDWSITEMVMCRGDQNRVIRHFHFTTWPDFGVPNPPQTLVRFVRAFRDKVPGDQRPIVVHCSAGVGRSGTLIALDRILQQLHT-SDVVDIYGIVWQMRKERVWMVQTEAQYICIHQCLLAVLEGNE---GNGNTREIHHNQGFEDDEGIAES 469          
The following BLAST results are available for this feature:
BLAST of HiSeq13103 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357613737|gb|EHJ68696.1|0.000e+091.35receptor protein-tyrosine phosphatase 10d [Danaus ... [more]
gi|913311311|ref|XP_013186327.1|0.000e+094.43PREDICTED: tyrosine-protein phosphatase 99A [Amyel... [more]
gi|913312142|ref|XP_013186783.1|0.000e+094.43PREDICTED: tyrosine-protein phosphatase 10D [Amyel... [more]
gi|952513800|gb|KRT80321.1|0.000e+076.10hypothetical protein AMK59_8445, partial [Oryctes ... [more]
gi|732597597|gb|JAG14222.1|0.000e+078.06Tyrosine-protein phosphatase 10D [Lygus hesperus][more]
gi|1080072043|ref|XP_018578511.1|0.000e+076.42PREDICTED: tyrosine-protein phosphatase 10D-like, ... [more]
gi|732576351|gb|JAG03599.1|3.944e-18076.83Tyrosine-protein phosphatase 10D [Lygus hesperus][more]
gi|1058244814|gb|JAT25902.1|5.366e-18074.53hypothetical protein g.34951, partial [Graphocepha... [more]
gi|355333041|pdb|3S3E|A2.558e-17879.45Chain A, Crystal Structure Of The Catalytic Domain... [more]
gi|1058093914|gb|JAS50616.1|2.747e-17874.53hypothetical protein g.40819, partial [Cuerna arid... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016311 dephosphorylation
biological_process GO:0035335 peptidyl-tyrosine dephosphorylation
biological_process GO:0006470 protein dephosphorylation
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0016791 phosphatase activity
molecular_function GO:0004725 protein tyrosine phosphatase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242Protein-tyrosine phosphatase, receptor/non-receptor typePRINTSPR00700PRTYPHPHTASEcoord: 102..122
score: 58.68
coord: 256..271
score: 31.25
coord: 185..202
score: 50.56
coord: 86..93
score: 74.04
coord: 272..282
score: 58.07
coord: 224..242
score: 69.41
IPR000242Protein-tyrosine phosphatase, receptor/non-receptor typeSMARTSM00194PTPccoord: 32..291
e-value: 4.1E-123
score: 425.0
IPR000242Protein-tyrosine phosphatase, receptor/non-receptor typePFAMPF00102Y_phosphatasecoord: 57..287
e-value: 1.3E-78
score: 263.5
IPR000242Protein-tyrosine phosphatase, receptor/non-receptor typePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 33..289
score: 54.598
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404PTPc_motifcoord: 186..288
e-value: 1.8E-40
score: 150.5
IPR029021Protein-tyrosine phosphatase-likeGENE3D3.90.190.10coord: 8..291
e-value: 3.1E-107
score: 357.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILY52799(Phosphotyrosine protein) phosphatases IIcoord: 11..288
NoneNo IPR availablePANTHERPTHR19134:SF251RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Ocoord: 8..296
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 8..296
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 227..237
IPR000387Protein-tyrosine/Dual specificity phosphatasePROSITEPS50056TYR_PHOSPHATASE_2coord: 205..280
score: 19.786

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13103HiSeq13103Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13103_p ID=HiSeq13103_p|Name=HiSeq13103|organism=Ostrinia scapulalis|type=polypeptide|length=324bp
PPPPPAPRTSRPVRVADFIDHYRLMSADSDFRFSEEFEELKHVGREQPCT
AADLPCNRPKNRFTNILPYDHSRYKLQPVDDEEGSDYINANYVPGHNSPR
EFIVTQGPLHCTRDDFWRMCWESGSRAIVMLTRCVEKGREKCDRYWPYDT
RPVYYGDIAVTALNESRYPDWTITELMVCRGSEQRVLKHFHFTTWPDFGV
PDPPTTLARFVRAFRERCPADARPVVVHCSAGVGRSGTFITLDRALQQLA
AHADALDVFGMVHAMRRERVWMVQTEQQYICIHQCLVAVLEGQDLQPPHH
NPHHHHHNPAFEGERERAAAPDAP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0016311dephosphorylation
GO:0006470protein dephosphorylation
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
Vocabulary: INTERPRO
TermDefinition
IPR000387Tyr/Dual-sp_Pase
IPR016130Tyr_Pase_AS
IPR029021Prot-tyrosine_phosphatase-like
IPR003595Tyr_Pase_cat
IPR000242Tyr_Pase_rcpt/non-rcpt