HiSeq13107_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13107
Unique NameHiSeq13107_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length55
Homology
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|913319902|ref|XP_013191041.1| (PREDICTED: cyclin-dependent kinases regulatory subunit-like [Amyelois transitella])

HSP 1 Score: 103.605 bits (257), Expect = 1.048e-27
Identity = 49/56 (87.50%), Postives = 51/56 (91.07%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR+DI  PVNGLD   NSAV+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDIQQPVNGLDATTNSAVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|512910038|ref|XP_004927069.1| (PREDICTED: cyclin-dependent kinases regulatory subunit [Bombyx mori])

HSP 1 Score: 102.449 bits (254), Expect = 2.906e-27
Identity = 48/56 (85.71%), Postives = 52/56 (92.86%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR+DI AP+NGLD   +SAV+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDIPAPLNGLDTNTSSAVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|544169299|gb|AGW00925.1| (cyclin-dependent kinase regulatory subunit 1 [Helicoverpa armigera])

HSP 1 Score: 101.293 bits (251), Expect = 7.715e-27
Identity = 48/56 (85.71%), Postives = 51/56 (91.07%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR++I APVNGLD   NS V+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTNIPAPVNGLDSNTNSTVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|357610022|gb|EHJ66790.1| (cyclin-dependent kinase regulatory subunit [Danaus plexippus])

HSP 1 Score: 99.7525 bits (247), Expect = 3.141e-26
Identity = 47/56 (83.93%), Postives = 50/56 (89.29%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR+DI  PVNGLD   +S V+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDIPPPVNGLDATTSSTVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|114051550|ref|NP_001040111.1| (cyclin-dependent kinase regulatory subunit [Bombyx mori] >gi|87248089|gb|ABD36097.1| cyclin-dependent kinase regulatory subunit [Bombyx mori])

HSP 1 Score: 100.138 bits (248), Expect = 9.627e-26
Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEP VLLFRRPR+DI AP+NGLD   +SAV+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPQVLLFRRPRTDIPAPLNGLDTNTSSAVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|509175533|gb|JAA85887.1| (Cyclin-dependent kinase subunit 85A [Pararge aegeria])

HSP 1 Score: 98.5969 bits (244), Expect = 1.351e-25
Identity = 46/56 (82.14%), Postives = 52/56 (92.86%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDI-APVNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRR R+D+ AP+NGLD+  NS+V+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRLRTDVPAPLNGLDLGNNSSVKV 93          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|768439638|ref|XP_011561460.1| (PREDICTED: cyclin-dependent kinases regulatory subunit [Plutella xylostella])

HSP 1 Score: 97.4413 bits (241), Expect = 2.378e-25
Identity = 47/57 (82.46%), Postives = 50/57 (87.72%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDIAP--VNGLDMKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR+D+    VNGLD   NSAV+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRADLPQPVVNGLDSNTNSAVRV 94          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|914577091|gb|KOB78862.1| (Cyclin-dependent kinases regulatory subunit [Operophtera brumata])

HSP 1 Score: 97.4413 bits (241), Expect = 2.865e-25
Identity = 48/57 (84.21%), Postives = 51/57 (89.47%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSD-IAPVNGLD-MKANSAVQV 55
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPR+D   PVNGLD   +NSAV+V
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRTDNQTPVNGLDSTNSNSAVKV 94          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|910339201|ref|XP_013173230.1| (PREDICTED: cyclin-dependent kinases regulatory subunit [Papilio xuthus] >gi|930655303|gb|KPI97634.1| Cyclin-dependent kinases regulatory subunit [Papilio xuthus])

HSP 1 Score: 87.0409 bits (214), Expect = 3.372e-21
Identity = 44/54 (81.48%), Postives = 47/54 (87.04%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDIAPV-NGLDMKANSAV 53
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP+S+I  V NGL   +NSA 
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPKSNIQHVMNGLG--SNSAT 89          
BLAST of HiSeq13107 vs. genbank:protein
Match: gi|909582531|ref|XP_013147300.1| (PREDICTED: cyclin-dependent kinases regulatory subunit [Papilio polytes])

HSP 1 Score: 85.8853 bits (211), Expect = 1.020e-20
Identity = 43/54 (79.63%), Postives = 46/54 (85.19%), Query Frame = 0
Query:    1 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDIAPV-NGLDMKANSAV 53
            MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP+S+I  V NG+    NSA 
Sbjct:   38 MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPKSNIQNVMNGIG--GNSAT 89          
The following BLAST results are available for this feature:
BLAST of HiSeq13107 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913319902|ref|XP_013191041.1|1.048e-2787.50PREDICTED: cyclin-dependent kinases regulatory sub... [more]
gi|512910038|ref|XP_004927069.1|2.906e-2785.71PREDICTED: cyclin-dependent kinases regulatory sub... [more]
gi|544169299|gb|AGW00925.1|7.715e-2785.71cyclin-dependent kinase regulatory subunit 1 [Heli... [more]
gi|357610022|gb|EHJ66790.1|3.141e-2683.93cyclin-dependent kinase regulatory subunit [Danaus... [more]
gi|114051550|ref|NP_001040111.1|9.627e-2683.93cyclin-dependent kinase regulatory subunit [Bombyx... [more]
gi|509175533|gb|JAA85887.1|1.351e-2582.14Cyclin-dependent kinase subunit 85A [Pararge aeger... [more]
gi|768439638|ref|XP_011561460.1|2.378e-2582.46PREDICTED: cyclin-dependent kinases regulatory sub... [more]
gi|914577091|gb|KOB78862.1|2.865e-2584.21Cyclin-dependent kinases regulatory subunit [Opero... [more]
gi|910339201|ref|XP_013173230.1|3.372e-2181.48PREDICTED: cyclin-dependent kinases regulatory sub... [more]
gi|909582531|ref|XP_013147300.1|1.020e-2079.63PREDICTED: cyclin-dependent kinases regulatory sub... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007049 cell cycle
biological_process GO:0051301 cell division
biological_process GO:0045859 regulation of protein kinase activity
molecular_function GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
molecular_function GO:0016301 kinase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000789Cyclin-dependent kinase, regulatory subunitPRINTSPR00296CYCLINKINASEcoord: 5..19
score: 75.38
coord: 20..34
score: 69.74
IPR000789Cyclin-dependent kinase, regulatory subunitSMARTSM01084CKScoord: 1..37
e-value: 2.9E-10
score: 50.1
IPR000789Cyclin-dependent kinase, regulatory subunitPFAMPF01111CKScoord: 1..36
e-value: 1.3E-18
score: 66.5
IPR000789Cyclin-dependent kinase, regulatory subunitGENE3D3.30.170.10coord: 1..37
e-value: 2.6E-19
score: 68.6
IPR000789Cyclin-dependent kinase, regulatory subunitPROSITEPS00945CKS_2coord: 23..33
IPR000789Cyclin-dependent kinase, regulatory subunitSUPERFAMILY55637Cell cycle regulatory proteinscoord: 1..37
NoneNo IPR availablePANTHERPTHR23415CYCLIN-DEPENDENT KINASES REGULATORY SUBUNIT/60S RIBOSOME SUBUNIT BIOGENESIS PROTEIN NIP7coord: 1..41

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13107HiSeq13107Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13107_p ID=HiSeq13107_p|Name=HiSeq13107|organism=Ostrinia scapulalis|type=polypeptide|length=55bp
MTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRPRSDIAPVNGLDMKAN
SAVQV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0051301cell division
GO:0045859regulation of protein kinase activity
GO:0007049cell cycle
Vocabulary: Molecular Function
TermDefinition
GO:0016301kinase activity
GO:0016538cyclin-dependent protein serine/threonine kinase regulator activity
Vocabulary: INTERPRO
TermDefinition
IPR000789Cyclin-dep_kinase_reg-sub