HiSeq13114_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13114
Unique NameHiSeq13114_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length297
Homology
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|509180745|gb|JAA88493.1| (DNA-directed RNA polymerase III subunit RPC6 [Pararge aegeria])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 251/297 (84.51%), Postives = 274/297 (92.26%), Query Frame = 0
Query:    1 MSESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLEQ 297
            MSE ++D++ EKIL+ AKKNPKGI+D DI  A+P L++AELV  INKLLQQG FD+Y QGGSL+YRLK Q+SKQ +KGADNEEKVV+NLIEEAGNKGIWIRDIR  SNLANTQLTKVLK+LE KK+IKAVKCVNASKKKVYML+NLEPDRS+SGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNN RGPI+GRTQSYATA EVQKYITDLGIS VKLEVEDVITILNTLVYDGKAESSVY DG+KVYRAIE+LI  PGLVQVPCGVCPLIHKCCSTGL+TPQDC YM+EWLEQ
Sbjct:    1 MSEKNDDQVTEKILNAAKKNPKGISDKDIAAAVPGLSSAELVTAINKLLQQGLFDLYNQGGSLIYRLKNQASKQVIKGADNEEKVVYNLIEEAGNKGIWIRDIRIRSNLANTQLTKVLKSLEGKKVIKAVKCVNASKKKVYMLFNLEPDRSISGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNSRGPIVGRTQSYATAAEVQKYITDLGISKVKLEVEDVITILNTLVYDGKAESSVYPDGNKVYRAIESLISPPGLVQVPCGVCPLIHKCCSTGLITPQDCKYMSEWLEQ 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|943941122|ref|XP_014371990.1| (PREDICTED: probable DNA-directed RNA polymerase III subunit RPC6 [Papilio machaon] >gi|930678241|gb|KPJ18219.1| DNA-directed RNA polymerase III subunit RPC6 [Papilio machaon])

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 250/295 (84.75%), Postives = 277/295 (93.90%), Query Frame = 0
Query:    2 SESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            S  ++D + EKIL++AKKNPKGI+D DI  A+P+L+AAELV+ INKLLQ+G FD+Y QGGSL+YRLK QSSKQAVKGADNEEKVV+NLIE+AGNKGIWIRDIR  SN+ANTQLTKVLKNLESKK+IKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNP+GP++GRTQS+A+AVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAES+V SDGSKVYRAIE+LIP PGLVQVPCGVCPLI KCCSTGL+TPQDC YM +WLE
Sbjct:    3 SSKNDDPISEKILNVAKKNPKGISDKDILAAVPELSAAELVSAINKLLQEGLFDLYNQGGSLIYRLKGQSSKQAVKGADNEEKVVYNLIEDAGNKGIWIRDIRLRSNIANTQLTKVLKNLESKKVIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPKGPVVGRTQSFASAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESNVLSDGSKVYRAIESLIPPPGLVQVPCGVCPLILKCCSTGLITPQDCKYMDDWLE 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|909560794|ref|XP_013135500.1| (PREDICTED: probable DNA-directed RNA polymerase III subunit RPC6 [Papilio polytes])

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 252/297 (84.85%), Postives = 278/297 (93.60%), Query Frame = 0
Query:    1 MSES-SEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            MS S ++D + EKIL++AKK+PKGI+D DI  A+P+L+AAELV+ INKLLQ+G FD+Y QGGSL+YRLK QSSKQAVKGADNEEKVV+NLIE+AGNKGIWIRDIR  SN+ANTQLTKVLKNLESKK+IKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNP+GP++GRTQS+A+AVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSV SDGSKVYRAIE+LIP PGLVQVPCGVCPLI KC STGL+TPQDC YM EWLE
Sbjct:    1 MSTSKNDDPISEKILNVAKKHPKGISDKDILAAVPELSAAELVSAINKLLQEGLFDLYNQGGSLIYRLKGQSSKQAVKGADNEEKVVYNLIEDAGNKGIWIRDIRLRSNIANTQLTKVLKNLESKKVIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPQGPVVGRTQSFASAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVLSDGSKVYRAIESLIPPPGLVQVPCGVCPLILKCSSTGLITPQDCKYMDEWLE 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|910334333|ref|XP_013170596.1| (PREDICTED: probable DNA-directed RNA polymerase III subunit RPC6 [Papilio xuthus] >gi|930649929|gb|KPI92275.1| DNA-directed RNA polymerase III subunit RPC6 [Papilio xuthus])

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 247/295 (83.73%), Postives = 276/295 (93.56%), Query Frame = 0
Query:    2 SESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            S  ++D + EKIL++AKKNPKGI+D DI  A+P+L+AAELV+ INKLLQ+G FD+Y QGGSL+YRLK Q+SKQAVKGADNEEKVV+NLIE+AGNKGIWIRDIR  SN+ANTQLTKVLKNLESKK+IKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNP+GP++GRTQS+A+AVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSV  DG+KVYRAIE+LIP PGLVQVPCGVCPLI KCCSTGL+TPQ+C YM +WLE
Sbjct:    3 SSKNDDPISEKILNVAKKNPKGISDKDILAAVPELSAAELVSAINKLLQEGLFDLYNQGGSLIYRLKGQTSKQAVKGADNEEKVVYNLIEDAGNKGIWIRDIRLRSNIANTQLTKVLKNLESKKVIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPKGPVVGRTQSFASAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVLPDGTKVYRAIESLIPPPGLVQVPCGVCPLILKCCSTGLITPQECKYMDDWLE 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|913296450|ref|XP_013184560.1| (PREDICTED: DNA-directed RNA polymerase III subunit RPC6 isoform X1 [Amyelois transitella])

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 247/293 (84.30%), Postives = 271/293 (92.49%), Query Frame = 0
Query:    4 SSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            SSED +KEKIL++AKKNPKGI+D DIT AIP+L+  E +A INKLLQQG  D++ QGGSL+YRLK Q++KQAVKGADNEEKVVFNLIEEAGNKGIWIRDIR  SNLANTQL KVLK+LESKKLIKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVD+LNRQC +FLQQRADKIKNNP+GPI+GRTQSYATA EVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESS+Y DGSKVYRAIE L+P+ GLVQVPCGVCPLIHKC +TGLV PQDC+Y+ EWLE
Sbjct:    5 SSEDVIKEKILNVAKKNPKGISDKDITAAIPELSTGERIAVINKLLQQGSIDLFNQGGSLIYRLKIQTNKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRVRSNLANTQLNKVLKSLESKKLIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDVLNRQCFKFLQQRADKIKNNPQGPIVGRTQSYATAAEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSIYPDGSKVYRAIEPLLPTTGLVQVPCGVCPLIHKCTTTGLVNPQDCVYINEWLE 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|914543885|gb|KOB57702.1| (DNA-directed RNA polymerase III subunit RPC6 [Operophtera brumata])

HSP 1 Score: 510.76 bits (1314), Expect = 0.000e+0
Identity = 242/296 (81.76%), Postives = 271/296 (91.55%), Query Frame = 0
Query:    1 MSESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            MS +  D+LKEKIL+IAKKNPKGI+ +DI  A+P+++AAELV  IN+LLQQ  FD++ QGG+L+YRLK Q+SKQAVKGADNEEKVV+NLIEEAG+KGIWIRDIR  SNLANTQLTKVLK+LE KK+IKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVDILN QCLRFL Q+ADKIKNNPRGPIIGRTQSYATA EVQKYITDLGIS V L+VEDVITILNTLVYDGKAES+VY DG+KV+RAIE+LIP PGLVQVPCG+CPL+HKC STGLV+PQDC YM EWLE
Sbjct:    1 MSSNKSDDLKEKILNIAKKNPKGISHDDIKAAMPEISAAELVTAINELLQQEHFDLFNQGGALIYRLKTQTSKQAVKGADNEEKVVYNLIEEAGDKGIWIRDIRVRSNLANTQLTKVLKSLEGKKVIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDILNVQCLRFLNQQADKIKNNPRGPIIGRTQSYATAAEVQKYITDLGISKVILDVEDVITILNTLVYDGKAESTVYPDGTKVFRAIESLIPPPGLVQVPCGICPLMHKCSSTGLVSPQDCTYMKEWLE 296          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|768419635|ref|XP_011550544.1| (PREDICTED: probable DNA-directed RNA polymerase III subunit RPC6 [Plutella xylostella])

HSP 1 Score: 508.449 bits (1308), Expect = 1.389e-180
Identity = 241/291 (82.82%), Postives = 262/291 (90.03%), Query Frame = 0
Query:    6 EDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            ED + EKIL+IAKKNPKGI+D DI+ A P+L+ A+ V  IN LLQQG FD+Y QGG+L+YRLKA SSKQAVKGADNEEKVV+NLIEEA NKGIWIRDIR  SNLA TQL KVLK+LESKKLIKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQ+FESEFVDILNRQCLRFLQQRADKIKNNPRGPI GRTQSYATA EVQKYI DLGIS + L+VEDVITILNTLVYDGKAESSVY DGS+VYRAIE+LIP+PGLVQVPCGVCPL++ CC TGLV PQDC YM EWLE
Sbjct:    7 EDSITEKILAIAKKNPKGISDKDISAAFPELSPADRVTAINALLQQGSFDLYNQGGALIYRLKAASSKQAVKGADNEEKVVYNLIEEAENKGIWIRDIRRRSNLAMTQLNKVLKSLESKKLIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQEFESEFVDILNRQCLRFLQQRADKIKNNPRGPIFGRTQSYATAAEVQKYIADLGISKITLDVEDVITILNTLVYDGKAESSVYPDGSRVYRAIESLIPAPGLVQVPCGVCPLVYNCCPTGLVNPQDCSYMTEWLE 297          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|389612872|dbj|BAM19835.1| (DNA-directed RNA polymerase III, 34kD-subunit, partial [Papilio xuthus])

HSP 1 Score: 505.368 bits (1300), Expect = 1.555e-179
Identity = 240/284 (84.51%), Postives = 267/284 (94.01%), Query Frame = 0
Query:    2 SESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTP 285
            S  ++D + EKIL++AKKNPKGI+D DI  A+P+L+AAELV+ INKLLQ+G FD+Y QGGSL+YRLK Q+SKQAVKGADNEEKVV+NLIE+AGNKGIWIRDIR  SN+ANTQLTKVLKNLESKK+IKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNP+GP++GRTQS+A+AVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSV  DG+KVYRAIE+LIP PGLVQVPCGVCPLI KCCSTGL+TP
Sbjct:    3 SSKNDDPISEKILNVAKKNPKGISDKDILAAVPELSAAELVSAINKLLQEGLFDLYNQGGSLIYRLKGQTSKQAVKGADNEEKVVYNLIEDAGNKGIWIRDIRLRSNIANTQLTKVLKNLESKKVIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPKGPVVGRTQSFASAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVLPDGTKVYRAIESLIPPPGLVQVPCGVCPLILKCCSTGLITP 286          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|357612377|gb|EHJ67947.1| (putative DNA-directed RNA polymerase III 39 kDa polypeptide [Danaus plexippus])

HSP 1 Score: 491.886 bits (1265), Expect = 1.817e-174
Identity = 234/269 (86.99%), Postives = 253/269 (94.05%), Query Frame = 0
Query:   29 ITTAIPDLTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLEQ 297
            +  A+P+LT+AELVA INKLLQQG FD+Y QGGSL+YRLK Q+SKQA+KGADNEEKVV+NLIEEAGNKGIWIRDIR  SNLANTQLTKVLK+LE KK+IKAVKCVNASKKKVYML+NLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPI+GRTQSYATA EVQKYITDLGIS VKLEVEDVITILNTLVYDGKAES+VY DG++VYRAIE+L+P PGLVQVPCGVCPLIHKC STGL+TPQDC YM EWLEQ
Sbjct:    1 MAAAVPELTSAELVAAINKLLQQGVFDLYNQGGSLLYRLKNQNSKQAIKGADNEEKVVYNLIEEAGNKGIWIRDIRIRSNLANTQLTKVLKSLEGKKVIKAVKCVNASKKKVYMLFNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIVGRTQSYATAAEVQKYITDLGISKVKLEVEDVITILNTLVYDGKAESNVYPDGNRVYRAIESLLPPPGLVQVPCGVCPLIHKCNSTGLITPQDCKYMDEWLEQ 269          
BLAST of HiSeq13114 vs. genbank:protein
Match: gi|913296456|ref|XP_013184569.1| (PREDICTED: DNA-directed RNA polymerase III subunit RPC6 isoform X2 [Amyelois transitella])

HSP 1 Score: 471.47 bits (1212), Expect = 2.049e-166
Identity = 223/261 (85.44%), Postives = 242/261 (92.72%), Query Frame = 0
Query:   36 LTAAELVATINKLLQQGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDRSVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQSYATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKVYRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLE 296
            +T  E +A INKLLQQG  D++ QGGSL+YRLK Q++KQAVKGADNEEKVVFNLIEEAGNKGIWIRDIR  SNLANTQL KVLK+LESKKLIKAVKCVNASKKKVYMLYNLEPDRS+SGGAWYQDQDFESEFVD+LNRQC +FLQQRADKIKNNP+GPI+GRTQSYATA EVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESS+Y DGSKVYRAIE L+P+ GLVQVPCGVCPLIHKC +TGLV PQDC+Y+ EWLE
Sbjct:    7 ITNGERIAVINKLLQQGSIDLFNQGGSLIYRLKIQTNKQAVKGADNEEKVVFNLIEEAGNKGIWIRDIRVRSNLANTQLNKVLKSLESKKLIKAVKCVNASKKKVYMLYNLEPDRSISGGAWYQDQDFESEFVDVLNRQCFKFLQQRADKIKNNPQGPIVGRTQSYATAAEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSIYPDGSKVYRAIEPLLPTTGLVQVPCGVCPLIHKCTTTGLVNPQDCVYINEWLE 267          
The following BLAST results are available for this feature:
BLAST of HiSeq13114 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|509180745|gb|JAA88493.1|0.000e+084.51DNA-directed RNA polymerase III subunit RPC6 [Para... [more]
gi|943941122|ref|XP_014371990.1|0.000e+084.75PREDICTED: probable DNA-directed RNA polymerase II... [more]
gi|909560794|ref|XP_013135500.1|0.000e+084.85PREDICTED: probable DNA-directed RNA polymerase II... [more]
gi|910334333|ref|XP_013170596.1|0.000e+083.73PREDICTED: probable DNA-directed RNA polymerase II... [more]
gi|913296450|ref|XP_013184560.1|0.000e+084.30PREDICTED: DNA-directed RNA polymerase III subunit... [more]
gi|914543885|gb|KOB57702.1|0.000e+081.76DNA-directed RNA polymerase III subunit RPC6 [Oper... [more]
gi|768419635|ref|XP_011550544.1|1.389e-18082.82PREDICTED: probable DNA-directed RNA polymerase II... [more]
gi|389612872|dbj|BAM19835.1|1.555e-17984.51DNA-directed RNA polymerase III, 34kD-subunit, par... [more]
gi|357612377|gb|EHJ67947.1|1.817e-17486.99putative DNA-directed RNA polymerase III 39 kDa po... [more]
gi|913296456|ref|XP_013184569.1|2.049e-16685.44PREDICTED: DNA-directed RNA polymerase III subunit... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006359 regulation of transcription from RNA polymerase III promoter
biological_process GO:0006351 transcription, DNA-templated
cellular_component GO:0005666 DNA-directed RNA polymerase III complex
molecular_function GO:0003677 DNA binding
molecular_function GO:0003899 DNA-directed RNA polymerase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007832RNA polymerase Rpc34PIRSFPIRSF028763RNAP3_C34/C39coord: 1..297
e-value: 3.3E-83
score: 277.1
IPR007832RNA polymerase Rpc34PFAMPF05158RNA_pol_Rpc34coord: 6..296
e-value: 2.3E-87
score: 293.1
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 81..182
e-value: 2.7E-5
score: 23.2
IPR016049RNA polymerase Rpc34-likePANTHERPTHR12780RNA POLYMERASE III (DNA DIRECTED), 39KD SUBUNIT-RELATEDcoord: 8..296
NoneNo IPR availablePANTHERPTHR12780:SF0DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC6coord: 8..296
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 75..146
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 6..68

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13114HiSeq13114Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13114_p ID=HiSeq13114_p|Name=HiSeq13114|organism=Ostrinia scapulalis|type=polypeptide|length=297bp
MSESSEDELKEKILSIAKKNPKGITDNDITTAIPDLTAAELVATINKLLQ
QGCFDIYKQGGSLVYRLKAQSSKQAVKGADNEEKVVFNLIEEAGNKGIWI
RDIRNGSNLANTQLTKVLKNLESKKLIKAVKCVNASKKKVYMLYNLEPDR
SVSGGAWYQDQDFESEFVDILNRQCLRFLQQRADKIKNNPRGPIIGRTQS
YATAVEVQKYITDLGISNVKLEVEDVITILNTLVYDGKAESSVYSDGSKV
YRAIEALIPSPGLVQVPCGVCPLIHKCCSTGLVTPQDCIYMAEWLEQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005666DNA-directed RNA polymerase III complex
Vocabulary: Biological Process
TermDefinition
GO:0006359regulation of transcription from RNA polymerase III promoter
GO:0006351transcription, DNA-templated
Vocabulary: Molecular Function
TermDefinition
GO:0003899DNA-directed RNA polymerase activity
GO:0003677DNA binding
Vocabulary: INTERPRO
TermDefinition
IPR016049RNA_pol_Rpc34-like
IPR011991WHTH_DNA-bd_dom
IPR007832RNA_pol_Rpc34