HiSeq13117_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13117
Unique NameHiSeq13117_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length751
Homology
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|943967402|ref|XP_014365673.1| (PREDICTED: putative uncharacterized protein DDB_G0282133 [Papilio machaon])

HSP 1 Score: 394.815 bits (1013), Expect = 8.373e-123
Identity = 316/779 (40.56%), Postives = 453/779 (58.15%), Query Frame = 0
Query:    1 MRSFLLITLFICLTTIALARPSRLDDRSDISEVEENEYEANEEENAAEDNVQE-NEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRAN-ADGFSECN--RGRGKGEKFEETIQANNELPSFSKRRQTNRYIDNSDVNDPPEKVQHLTNN-YKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG--NRDRRQAEASN-----SINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSI-DINTESAVSQSADLENTKQESQTESVDISTKTADTTRAETPESRAELLSEPND------AASNSKLDSSAYDTN-DASSSVQ-STKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLH-NNEHQYKREIQ-DNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEG----------IDQGRPLRSTPSPEENAK-LPDSFIN--VPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            MR+F + +L   +  ++ A+P  L       E  E EYE NEE  AAED  Q+ ++DS +  QE  +     E+             P + +     R   N  D F E +      + +K   T   +N  P   + RQ + Y +N++     E  QH  +N +KTNR Q    +N  +KR +    +S D+ D +F+NNR+  N  +K  Y  E  +   Q R FK     M  E+K     K Y+    NR+RRQ   SN       N S+ S + + I  ++ NE++E+AI+RH+KKLSG ELEEL N+LSDDK+ LL +IIDND +  DTV+KREITKKAGAVE+N+YI++G  + SK+QG S ++ + NTE+++S      + K  S TE  +I   +  +   +  E++ + L+ PN+      +  N  L+S   DT+ D  S+ Q  TK +NKRE N++   N + S DDTQI D  ++ KD   S N+Q  F  QDD+L+ LI+EE +   ++++  KRE   D SVD+ +S+KSLEESFPN    +++  ++ S+MAPLVRVKRKD D  I KR+A+V+ D+ V +FP K ENDD D DEGSEF++DGFYDRTSN+A+N+ NKP D +  K   R    KA+ +         N+ ++SDT +LGSDTD+ ++G EG++DNLM+ S  R+RRT E+ +           I   R LRSTP  +  AK + ++ IN  VP YQE+DAFG LPR+YEG+LGRYKRIRRVK
Sbjct:    1 MRTFFIFSLIFYIFEVSSAKPLSLI-AEQTREAGEAEYEGNEE-TAAEDYQQDSDQDSSVDTQEGANNNGRREAVQDNSRLPDLNNNPYKQHTNNLQRGHLNNFDNFPEISGISRDARNDKISRTNVDSNSKPG-GRYRQPDTYSENNE----QEARQHFDDNAFKTNRAQNLGFDNNINKRAMLPPGAS-DEGDLLFENNRDQLNKLDKSGYARE-GEPGLQPRFFKHQTYNMPGENKEAPDFKRYDKWRLNRNRRQTPKSNLKINDEANESTPSPDSKEI--DLVNEDEESAIKRHVKKLSGPELEELFNTLSDDKRNLLKKIIDNDSDNDDTVSKREITKKAGAVEQNSYIENGQLDSSKIQGVSSNVEESNTETSLSHETTETSKKSVSATELGEI-MPSKSSGGCDKSENKLD-LTNPNEDLKEVKSEGNLDLESKKSDTDVDLESNSQIMTKNDNKREANINEMTNMEKSSDDTQIVDRDYSLKDFQGSMNNQDMFL-QDDELTDLINEETERQTSHKNGLKREASPDESVDLSESIKSLEESFPNPKSYDDSNPFYGSDMAPLVRVKRKDADSAIMKRSASVIADSNVPYFPNKGENDDEDNDEGSEFDEDGFYDRTSNFARNNDNKPFDTSRAKE-YRIFNQKASHS-------YGNENLDSDTANLGSDTDNAMTGAEGINDNLMY-SALRDRRTLEENDNSKVLDDKIKDILPERRLRSTPLMDNQAKTVSETNINVPVPGYQENDAFGPLPRSYEGDLGRYKRIRRVK 756          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|910319664|ref|XP_013162704.1| (PREDICTED: putative uncharacterized protein DDB_G0282133 [Papilio xuthus])

HSP 1 Score: 394.43 bits (1012), Expect = 1.394e-122
Identity = 315/778 (40.49%), Postives = 450/778 (57.84%), Query Frame = 0
Query:    1 MRSFLLITLFICLTTIALARPSRLDDRSDISEVEENEYEANEEENAAEDNVQE-NEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRAN-ADGFSECNRGR--GKGEKFEETIQANNELPSFSKRRQTNRYIDNSDVNDPPEKVQHLTNN-YKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG--NRDRRQAEASN-----SINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSI-DINTESAVSQSADLENTKQESQTESVDISTKTADTTRAETPESRAELLSEPNDAASNSK------LDSSAYDTN-DASSSVQ-STKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLH-NNEHQYKREIQ-DNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEG---------IDQGRPLRSTPSPEENAK-LPDSFIN--VPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            MR+F + +L   L  ++ A+P  L       E  E EYE NEE  AAED  Q+ ++DS +  QE  ++    E+             P + +     R   N  D F E +      + +K   T   +N  P   + RQ + Y +N++     +  QH  +N YK N  Q    +N  +KR +    +S D+ D +F+NNR+  N  +K  Y  E  +   Q R FK     M  E+K     K Y+    NR+RRQ   +N       N S+ S + + I  ++ NE++E+AI+RH+KKLSG ELEEL N+LSDDK++LL +IIDND +  DTV+KREITKKAGAVE+N+YI++G  + SK+QG S ++ + NTE+++S      + K  S TE  +I   +  +   +  E++ + L+ PN+     K      L+S   DT+ D  S+ Q  TK +NKRE N++   N + S DDTQI D  ++ KD   S N+Q  F  QDD+L+ LI+EE +   ++++  KRE   D SVD+  S+KSLEESFPN    +E+  ++ S+MAPLVRVKRKD D  I KR+A+V+ D+ V +FP K ENDD D DEGSEF++DGFYDRTSN+A+N+ NKP D +  K   R    KA            N+ +ESDT +LGSDTD+ ++G EG++DNLM+ S  R+RRT+E+ +          +   R LRSTP  +  AK + ++ IN  VP YQE+DAFG LPR+YEG+LGRYKRIRRVK
Sbjct:    1 MRTFFIFSLIFYLFEVSSAKPLSLI-AGQTRETGEAEYEGNEE-TAAEDYQQDSDQDSSVDTQEGTNSNGRREAVQDNSRLPDLNNNPYKQHSNNLQRGHLNNFDNFPEISGISRDARNDKISNTNIDSNGKPG-GRYRQPDTYSENNE----QDARQHFNDNAYKINHAQNLGFDNNINKRAMLPPGAS-DEGDLLFENNRDQLNKLDKSGYARE-GEPGLQPRFFKHQAYNMPGENKEAPDFKRYDKWRLNRNRRQTPKTNLKTNDEANESTPSADSKEI--DLVNEDEESAIKRHVKKLSGPELEELFNTLSDDKRSLLKKIIDNDADNDDTVSKREITKKAGAVEQNSYIENGQLDSSKIQGVSSNVEESNTETSLSHETTETSKKSVSATELGEI-MPSKSSGGCDKSENKLD-LANPNEDLKEVKSEGILDLESKKSDTDVDLESNSQIMTKNDNKREANINEMTNMEKSSDDTQIVDRDYSLKDFQGSMNNQDMFL-QDDELTDLINEETERQTSHKNGLKREASPDESVDLSKSIKSLEESFPNPKSYDESNPFYGSDMAPLVRVKRKDADSAIMKRSASVIADSNVPYFPNKGENDDEDNDEGSEFDEDGFYDRTSNFARNNDNKPYDTSCAKEEDRIFNQKAGHI-------YGNENLESDTSNLGSDTDNAMTGAEGINDNLMY-SALRDRRTSEENDNKVLDDKIKDMSPERRLRSTPLMDNQAKTVSETNINVPVPGYQENDAFGPLPRSYEGDLGRYKRIRRVK 756          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|909563721|ref|XP_013137097.1| (PREDICTED: probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 [Papilio polytes])

HSP 1 Score: 390.578 bits (1002), Expect = 3.173e-121
Identity = 315/780 (40.38%), Postives = 453/780 (58.08%), Query Frame = 0
Query:    1 MRSFLLITLFICLTTIALARPSRLDDRSDISEVEENEYEANEEENAAEDNVQE-NEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRAN-ADGFSECNRGRGKGEKFEETIQAN---NELPSFSKRRQTNRYIDNSDVNDPPEKVQHLTNN-YKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG--NRDRRQAEASN-----SINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSI-DINTESAVSQSADLENTKQESQTESVDISTKTADTTRAETPESRAELLSEPND------AASNSKLDSSAYDTN-DASSSVQ-STKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLH-NNEHQYKREI-QDNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEG----------IDQGRPLRSTPSPEENAK-LPDSFIN--VPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            MR+F +++L   L  +  A+P  L       E  E EYE NEE  AAED  Q+ ++DS +  QE  +     E+  Q          P + +     R   N  D F E + G  +  + ++T   N   N  P+  + RQ + Y +N++     E  QH   N +K N  Q    +N  +KR +    +S D+ D +F+NNR+  N  +K  Y  E  +S  Q R FK     +  E K     K Y+    NR+RRQ   +N      +N S+ + + + +  ++ NE++E+AI+RH+KKLSG ELEEL N+LSDDK+ LL +IIDND +  DTV+KREITKKAGAVE+N+YI++G  + SK+QG S ++ + NTE+++S      + K  S TE  +I   +  +   +  E++ + L+ PN+      +  N  L+S   DT+ D  S+ Q  +K ENKRE N++   N + S DDTQI D  ++ KD   S N+Q  F  QDD+L+ LI++E +   ++++  KRE  QD SVD+ +S+KSLEESFPN    +E+  ++ S+MAPLVRVKRKD D  I KR+A+V+ D+ V +FP K ENDD D DEGSEF++DGFYDRTSN+A+N+ NKP D    K   R    K+             D +ESDT +LGSDTD+ ++G EG++DNLM+ S  R+RRT+E+ +           I   R LRSTP  +  AK + ++ IN  VP YQE+DAFG LPR+YEG+LGRYKRIRRVK
Sbjct:    1 MRTFFILSLIFYLLEVLSAKPLSLV-AGQTRETGEAEYEGNEE-TAAEDYQQDSDQDSSVDTQEGANNNGRREAV-QDNSHLPDLNNPYKQHTNNLQRGHLNNFDNFPEIS-GISRDARNDKTSSTNVDSNGKPN-GRYRQPDTYAENNE----QEARQHFNENAFKMNHAQNLGFDNNINKRAMLPPGAS-DEGDLLFENNRDQLNKLDKSGYARE-GESGLQPRFFKHQTYNIPGESKETPDFKRYDKWRLNRNRRQTPKNNLKTNDEVNESTPAVDSKEL--DLVNEDEESAIKRHVKKLSGPELEELFNTLSDDKRNLLKKIIDNDSDNDDTVSKREITKKAGAVEQNSYIENGQLDSSKIQGVSSNVEESNTETSLSHETTETSKKSVSATELGEI-MPSKSSGGCDKSENKLD-LANPNEDLKEVKSEGNLDLESKKSDTDVDLESNSQIMSKNENKREANINEMTNMEKS-DDTQIVDRDYSLKDFQGSMNNQDMFL-QDDELTDLINDETERQTSHKNGLKREAPQDESVDLAESIKSLEESFPNPKSYDESNPFYGSDMAPLVRVKRKDADSAIMKRSASVIADSNVPYFPNKGENDDEDNDEGSEFDEDGFYDRTSNFARNNDNKPFDIPCAKEDDRVFNQKSG-------HTYGGDNLESDTANLGSDTDNAMTGAEGINDNLMY-SALRDRRTSEENDNNKILDDKVKDISPERRLRSTPLMDNQAKTVSETNINVPVPGYQENDAFGPLPRSYEGDLGRYKRIRRVK 755          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|930668681|gb|KPJ09687.1| (hypothetical protein RR48_13321 [Papilio machaon])

HSP 1 Score: 382.874 bits (982), Expect = 7.162e-118
Identity = 309/748 (41.31%), Postives = 438/748 (58.56%), Query Frame = 0
Query:   32 EVEENEYEANEEENAAEDNVQE-NEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRAN-ADGFSECNRGR--GKGEKFEETIQANNELPSFSKRRQTNRYIDNSDVNDPPEKVQHLTNN-YKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG--NRDRRQAEASN-----SINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSI-DINTESAVSQSADLENTKQESQTESVDISTKTADTTRAETPESRAELLSEPND------AASNSKLDSSAYDTN-DASSSVQ-STKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLH-NNEHQYKREIQ-DNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEG----------IDQGRPLRSTPSPEENAK-LPDSFIN--VPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            E  E EYE NEE  AAED  Q+ ++DS +  QE  +     E+             P + +     R   N  D F E +      + +K   T   +N  P   + RQ + Y +N++     E  QH  +N +KTNR Q    +N  +KR +    +S D+ D +F+NNR+  N  +K  Y  E  +   Q R FK     M  E+K     K Y+    NR+RRQ   SN       N S+ S + + I  ++ NE++E+AI+RH+KKLSG ELEEL N+LSDDK+ LL +IIDND +  DTV+KREITKKAGAVE+N+YI++G  + SK+QG S ++ + NTE+++S      + K  S TE  +I   +  +   +  E++ + L+ PN+      +  N  L+S   DT+ D  S+ Q  TK +NKRE N++   N + S DDTQI D  ++ KD   S N+Q  F  QDD+L+ LI+EE +   ++++  KRE   D SVD+ +S+KSLEESFPN    +++  ++ S+MAPLVRVKRKD D  I KR+A+V+ D+ V +FP K ENDD D DEGSEF++DGFYDRTSN+A+N+ NKP D +  K   R    KA+           N+ ++SDT +LGSDTD+ ++G EG++DNLM+ S  R+RRT E+ +           I   R LRSTP  +  AK + ++ IN  VP YQE+DAFG LPR+YEG+LGRYKRIRRVK
Sbjct:   56 EAGEAEYEGNEE-TAAEDYQQDSDQDSSVDTQEGANNNGRREAVQDNSRLPDLNNNPYKQHTNNLQRGHLNNFDNFPEISGISRDARNDKISRTNVDSNSKPG-GRYRQPDTYSENNE----QEARQHFDDNAFKTNRAQNLGFDNNINKRAMLPPGAS-DEGDLLFENNRDQLNKLDKSGYARE-GEPGLQPRFFKHQTYNMPGENKEAPDFKRYDKWRLNRNRRQTPKSNLKINDEANESTPSPDSKEI--DLVNEDEESAIKRHVKKLSGPELEELFNTLSDDKRNLLKKIIDNDSDNDDTVSKREITKKAGAVEQNSYIENGQLDSSKIQGVSSNVEESNTETSLSHETTETSKKSVSATELGEI-MPSKSSGGCDKSENKLD-LTNPNEDLKEVKSEGNLDLESKKSDTDVDLESNSQIMTKNDNKREANINEMTNMEKSSDDTQIVDRDYSLKDFQGSMNNQDMFL-QDDELTDLINEETERQTSHKNGLKREASPDESVDLSESIKSLEESFPNPKSYDDSNPFYGSDMAPLVRVKRKDADSAIMKRSASVIADSNVPYFPNKGENDDEDNDEGSEFDEDGFYDRTSNFARNNDNKPFDTSRAKE-YRIFNQKAS-------HSYGNENLDSDTANLGSDTDNAMTGAEGINDNLMY-SALRDRRTLEENDNSKVLDDKIKDILPERRLRSTPLMDNQAKTVSETNINVPVPGYQENDAFGPLPRSYEGDLGRYKRIRRVK 781          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|913313341|ref|XP_013187443.1| (PREDICTED: putative uncharacterized protein DDB_G0282499 [Amyelois transitella])

HSP 1 Score: 351.288 bits (900), Expect = 1.855e-108
Identity = 247/585 (42.22%), Postives = 348/585 (59.49%), Query Frame = 0
Query:  181 SQTSSLDDSDAIFDNNRENRNSGEKVEYNNEV----ADSSEQSRH---FKQYYNTMQSEHKSMLGDKNYEM----GNRDRRQAEASNSINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSID----INTESAVSQSADLENTK-QESQTESVDISTKTADTTRAETPESRAELLSEPNDAASNSKLDSSAYDTNDASSSVQSTKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLHNN--EHQYKRE-IQDNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEGIDQGRPLRSTPSPEENAKLPDSFINVPNYQESDAFGSLPRNYEGELGRYKRIRRVKPPA 745
            ++T+  D  D +F    EN  S E++  NN       D+S +  H   FK YY ++Q+       ++NYE       RDRRQA+ + S   S  S  K+     I  E +E AI+RHIKKLS +EL+ LLNSL ++K+ LLN+IIDND+N YD V+KR+ITKKAGAVEEN   ++ + + +KV G S  I      NTE+        EN K  E  TE  ++S+    ++     +  +  ++E   +  N    ++    +   S++Q +K  +KRET+++Y  N    F D +  +   N  D  ++ N++  F  Q++DL+Q +  +  L NN  EH  KRE + +N+    DS KSLE+SFPNSN  +E+G+Y E +M PLVRVKR++D   IKKR+A ++P+ + A+ P +AENDD D++EG+EFEDDG YDR+SNYAKN       N     G +    K   A+ S+ E+     +ESDTM++GSD+DSVLSGVEGVDDNLM+NSG+RN+RT E    + Q   L S  + E   K P   +N  NYQE+D+FG LPRNYEGEL R KRIRRVKPP 
Sbjct:   21 AKTTVNDSGDELF----ENAISKERIYKNNNNQRPDVDASNEPDHEAFFKNYYKSLQA------AERNYENIPPNVYRDRRQAQDAGSAVSSVNSIIKDNSKNTIY-ENEENAIKRHIKKLSEQELQSLLNSLPEEKRTLLNKIIDNDKNHYDGVSKRDITKKAGAVEENIDNENSVFDSNKVHGSSEDIKNDVGCNTETT-------ENVKTTEYHTEMSEMSSPKKTSSEELVHDKDSAFVNEAEKSTVNLNDSNNKESKSQVESNIQPSKLNSKRETSLNYVDNECSKFKDIKSVNTDLNPIDASENLNEETGFNYQNEDLTQFMGSDVLLDNNVIEHANKREALLENT----DSFKSLEDSFPNSNTYKESGEYSEIDMVPLVRVKRRNDGTFIKKRSAQIIPNDRAAYIP-RAENDDDDSEEGNEFEDDGLYDRSSNYAKN-------NFVDVSGKKIHNEKKEQADISREEN-----IESDTMNIGSDSDSVLSGVEGVDDNLMYNSGTRNKRTFE-MNTLGQDTELSSIVNVE--PKTPSDNLNAANYQENDSFGPLPRNYEGELNRLKRIRRVKPPC 567          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|930664423|gb|KPJ05741.1| (hypothetical protein RR46_02263 [Papilio xuthus])

HSP 1 Score: 334.724 bits (857), Expect = 7.420e-101
Identity = 257/621 (41.38%), Postives = 365/621 (58.78%), Query Frame = 0
Query:  154 QHLTNN-YKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG--NRDRRQAEASN-----SINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSID-INTESAVSQSADLENTKQESQTESVDISTKTADTTRAETPESRAELLSEPNDAASNSK------LDSSAYDTN-DASSSVQ-STKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLH-NNEHQYKREIQ-DNSVDVDDSMKSLEESFPNSNC-EENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEG---------IDQGRPLRSTPSPEENAK-LPDSFIN--VPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            QH  +N YK N  Q    +N  +KR +    +S D+ D +F+NNR+  N  +K  Y  E  +   Q R FK     M  E+K     K Y+    NR+RRQ   +N       N S+ S + + I  ++ NE++E+AI+RH+KKLSG ELEEL N+LSDDK++LL +IIDND +  DT++                        SK+QG S +++  NTE+++S      + K  S TE  +I   +  +   +  E++ +L + PN+     K      L+S   DT+ D  S+ Q  +K +NKRE N++   N + S DDTQI D  ++ KD   S N+Q  F  QDD+L+ LI+EE +   ++++  KRE   D SVD+ +S+KSLEESFPN    +E+  ++ S+MAPLVRVKRKD D  I KR+A+V+ D+ V +FP K ENDD D DEGSEF++DGFYDRTSN+A+N+ NKP D +  K   R    KA            N+ +ESDT +LGSDTD+ ++G EG++DNLM+ S  R+RRT+E+ +          +   R LRSTP  +  AK + ++ IN  VP YQE+DAFG LPR+YEG+LGRYKRIRRVK
Sbjct:   84 QHFNDNAYKINHAQNLGFDNNINKRAMLPPGAS-DEGDLLFENNRDQLNKLDKSGYARE-GEPGLQPRFFKHQAYNMPGENKEAPDFKRYDKWRLNRNRRQTPKTNLKTNDEANESTPSADSKEI--DLVNEDEESAIKRHVKKLSGPELEELFNTLSDDKRSLLKKIIDNDADNDDTLDS-----------------------SKIQGVSSNVEESNTETSLSHETTETSKKSVSATELGEI-MPSKSSGGCDKSENKLDL-ANPNEDLKEVKSEGILDLESKKSDTDVDLESNSQIMSKNDNKREANINEMTNMEKSSDDTQIVDRDYSLKDFQGSMNNQDMFL-QDDELTDLINEETERQTSHKNGLKREASPDESVDLSESIKSLEESFPNPKSYDESNPFYGSDMAPLVRVKRKDADSAIMKRSASVIADSNVPYFPNKGENDDEDNDEGSEFDEDGFYDRTSNFARNNDNKPYDTSCAKEEDRIFNQKAGHI-------YGNENLESDTSNLGSDTDNAMTGAEGINDNLMY-SALRDRRTSEENDNKVLDDKIKDMSPERRLRSTPLMDNQAKTVSETNINVPVPGYQENDAFGPLPRSYEGDLGRYKRIRRVK 666          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|768412752|ref|XP_011568467.1| (PREDICTED: dentin sialophosphoprotein-like [Plutella xylostella])

HSP 1 Score: 317.005 bits (811), Expect = 1.104e-93
Identity = 285/793 (35.94%), Postives = 418/793 (52.71%), Query Frame = 0
Query:    1 MRSFLLITLFICLTTIALARPSRLDDRSD--ISEVEENEYEANEEENAAEDNVQENEDSRLSDQEAGDTAADEESRNQQPMR-FGREKYPQRNYMEEADRPRANADGFSECNRGRGKGEKFEETIQAN---NELPSFSKRRQTNRYIDNSDVNDPPEKVQHLT--NNYKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQY--YNTMQSEHKSMLGDKNYE---MGNRDRRQAEASNSINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRII-DNDRNAYDT-------VNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSIDINTESAVSQSADLENTKQESQ-----TESVDISTKTADTTRAETPESRAELLSEPNDAASNSKLDSSAYDTNDASSSVQSTKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLHNNEHQYKREI---QDNSVDVDDSMKSLEESFPNSNCEENGQYFE----SNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANV-AEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTA----------EDPEGIDQGRPLRSTPSPEENAKLPDSFINVPNYQESDAFGSLPRNYEGELGRYKRIRRVKP-PAPSD 748
            MR   ++ LF      A+A+P+ ++D+ +    E EE +Y+A +EE   ++     +++ + D  A   A +E     +  R   R +   R   +  DR   NAD            E+ E+T+Q +   +E P     RQ  R   + +  + P   QH    N YK        R  EYD R       +LDD +A F+N+    N  +K   N E +D+++ S  ++ Y  YNTM +++K    D ++      NR RR A+  N+     TS   E  + E++ +E+EAAI+RHI KL+ +ELE+LL++LS+DK+ LL +II DND+N           + KREITKKAGA+ ENN IDS   +  K QGG+  I  +  + +S +  + N   E++     T+S  ++ KT          + AE  ++P   +S+ +  S              TKT NKRE   D+F+  D +  D  + D             +Q +FC++DD L+   +EE+ ++ N +  KR I   Q+NS D++DSM SLE+SF NSN      Y E    S+M P VRVKRK+ DLV+KKRAAA+LP++KVA+ P++ EN+D DT E +EFEDDG Y R SN      NK    +     VRS + + N  A DS  + S         + +GSD+DSVLSG EGVDDNLMFN+ +RN+R+A          ED + ++    + +     E+ KL D+ +N+  YQE+DAFG LPRNYEGEL RYKRIRRVK  PA  D
Sbjct:    9 MRFTKVLLLFSSFLVFAIAKPAYINDQINDRYEEAEEGDYDAMDEEAGVDEPADLQDEANVKDSRANYDAEEEPPSGPEAERQLRRARLQARIQAQAEDR---NAD------------EESEQTVQDSEDADEDPEPQDNRQ--RSATDYENEERPRPRQHTPARNRYKH------YRQREYDARNNRMPQQNLDD-EAAFENSGSVHNQKQKYS-NAEYSDANDDS-DYENYRNYNTMNTKNKKAKIDSSFYGNITANRQRRHADVQNA-----TSAPVEKPAGEVAKKEEEAAIKRHIDKLTTDELEQLLSTLSEDKRTLLAKIIMDNDKNVNTAKLIDNSDLKKREITKKAGAMNENNLIDSNQLD-EKAQGGA-DISSDVTNLLSGNGTINNMVVEAENITDSTQSALVADKTEVNKEVNLVANAAEPAADPTPKSSDPEQQSP-------------TKTANKREARYDHFRADDSALMDQNLLD-------------EQENFCNRDDQLTDYANEESDMYENNNIRKRHIIYEQENS-DINDSMNSLEDSFGNSNT-----YDEIDSGSDMEPHVRVKRKNPDLVVKKRAAALLPESKVAYVPFRTENEDEDTAEANEFEDDGLYVRPSNLEGELNNKEVPQS----KVRSNKKRFNFRASDSNRQAS--------DVGIGSDSDSVLSGSEGVDDNLMFNNAARNKRSANVGAQYTNENEDSDKLNDRAEMAA-----ESQKLSDNNMNLA-YQENDAFGPLPRNYEGELNRYKRIRRVKHLPASHD 718          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|357626235|gb|EHJ76394.1| (hypothetical protein KGM_11189 [Danaus plexippus])

HSP 1 Score: 221.09 bits (562), Expect = 1.272e-58
Identity = 251/766 (32.77%), Postives = 391/766 (51.04%), Query Frame = 0
Query:    3 SFLLITLFICLTTIALARPSRLDDRSDISEVEENEYEANEEENAAEDNVQENEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRAN-----ADGFSECNRGRGKGEKFEETIQANNELPSFSKRRQTNRYIDNSDVNDPPEKVQHLTNNYKTNRVQGDSRNNEYDKRTIDSQTSSLDDSD-AIFDNNRENRNSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMG-NRDRRQAEASNSINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLNSLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEISKVQGGSPSIDINTESAVSQSADLENTKQESQTESVDISTKT----ADTTRAETPESRAELLSEPNDAASNSK---LDSSAYDTNDASSSVQSTKTENKRETNVDYFKNPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLHNNEHQYKREIQD-NSVDVDDSMKSLEESFPNSNCEENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDN-----TDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRT-----AEDPEGIDQGRPLRSTPSPEE-NAKLPDSFINVPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            +F ++ + + ++    ++P +L++ ++ SE+ +++Y +N++  +A D  QE+E            A DE  +N+  +  G++   +RN     DR  A        G S  +R R +     +TI     L + S   +TN   D        EK+   T +YK N   GD+         I  +  + D  D  +F   +E  N+ +++EY NE     EQ R  K+  N+ +       G K Y++  NR+RRQA  +   + +ST ++K+ I    S  + E++I ++IKKLS ++LEELLNSL +DKK +L +I++          KREITKKAGAVEEN Y++ G S+ SK +GG   +D +T S    S         S T++ DIS  T    A++T+    E+ +  L + +    NSK   L+     ++D     +  K+ENKRE     + N     D+   +DN  N    D+S       C ++D+L     ++ + + N    KRE+ D N  +++ S++SLEESF +    E+       ++PL+RVKR + D    KR +  L + KV F P   E+   + DE SE ED G  DR+SNY +++ N  G       T   YG R +  K N  E S  + +A    E+    LGSDTDSVLSGVEG+DDNLM+NSG RN+RT      +D   +   R  R+  S ++ N  + D+ INV NY E +AFG + RNYEG+  R+KRIR++K
Sbjct:    5 TFKILLILLGISCFVTSKPLQLEEDNN-SEIGDSDYNSNDD--SASDEYQEDE------------ALDEAPQNRNVVPVGQDL--KRNLKLVPDRRHARNRYEELSGKSNPDRQRQR-----KTIANLEHLKTDSDNEETNEEAD-------AEKINKDTEHYKKNTELGDT--------NIKEKPFASDYVDEPLFKVKQEGYNT-DRIEYINEQL-PREQLRRVKEIENSHKMRSSGCRGRK-YDLEINRNRRQAPNAEVTDNNSTPSQKQDID---SKGDSESSIIKNIKKLSEQDLEELLNSLPEDKKNILKKIME----------KREITKKAGAVEEN-YLEGGQSDTSKNEGGF-LLDSSTTSEPPFS---------SSTDTTDISKHTDIGDAESTKTSENENESGKLQDKS-LFINSKEPNLNVGYVISDDNLKDEEPVKSENKREIVQAEYSN-----DNENGADNVENADLKDES-------CIENDELLPQKGDKIKTNAN----KREVSDENPSELNGSIQSLEESFSSDTTGES-------LSPLIRVKRTEKDHSCNKRDSNNLSNMKVPFSP-AVESGGSENDERSEIEDYGILDRSSNYERSEENNNGQEKVFHETPEIYG-RDL--KFNPIEHSGKDMNA----ETGKACLGSDTDSVLSGVEGIDDNLMYNSGLRNKRTEVSSDLDDSHQVQLNRNGRTAGSLDDSNNAVTDNSINVHNYGEEEAFGPISRNYEGDNSRFKRIRQIK 674          
BLAST of HiSeq13117 vs. genbank:protein
Match: gi|827538073|ref|XP_004922373.2| (PREDICTED: putative uncharacterized protein DDB_G0282499 [Bombyx mori])

HSP 1 Score: 170.629 bits (431), Expect = 4.521e-41
Identity = 99/243 (40.74%), Postives = 147/243 (60.49%), Query Frame = 0
Query:  505 YKREIQDNSVDVDDSMKSLEESFPNSNCEENGQYFESNMAPLVRVKRKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRTSNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKV---ESDTMSLGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEGIDQGRPLRSTPSPEENAKLPDS--FINVPNYQESDAFGSLPRNYEGELGRYKRIRRVK 742
            +KREI+ +  ++  S++SLE+SFPN+N +EN   +     P +RVKR D + ++KKR A +LP+ K+ +F YKAEN D D DEG+EF+D+ F+D  S  ++N       N   +Y    +++  N  E +K  D +N  +   + +T ++GSDTD++LSG+E +DD LM +  SRN+R       ++Q        S  ++   P S  +IN P Y E DAFG LP N  G+LGRYKRIRRVK
Sbjct:  430 FKREIEADD-EISQSLQSLEDSFPNTNIDENPLLYS---EPRIRVKRTDSNQIVKKRGAGILPEGKMGYFSYKAENQDEDNDEGNEFDDESFFDNLSESSRN-------NVGLEYS--DLKNTKNCNEKAKSYDPSNISIYNAQKETENVGSDTDTILSGMENIDDKLMLSGDSRNKRQL-----LNQSNKYLDKSSISDDRVEPSSEKYINSPGYHEDDAFGPLPHNSVGDLGRYKRIRRVK 654          
The following BLAST results are available for this feature:
BLAST of HiSeq13117 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 9
Match NameE-valueIdentityDescription
gi|943967402|ref|XP_014365673.1|8.373e-12340.56PREDICTED: putative uncharacterized protein DDB_G0... [more]
gi|910319664|ref|XP_013162704.1|1.394e-12240.49PREDICTED: putative uncharacterized protein DDB_G0... [more]
gi|909563721|ref|XP_013137097.1|3.173e-12140.38PREDICTED: probable cyclin-dependent serine/threon... [more]
gi|930668681|gb|KPJ09687.1|7.162e-11841.31hypothetical protein RR48_13321 [Papilio machaon][more]
gi|913313341|ref|XP_013187443.1|1.855e-10842.22PREDICTED: putative uncharacterized protein DDB_G0... [more]
gi|930664423|gb|KPJ05741.1|7.420e-10141.38hypothetical protein RR46_02263 [Papilio xuthus][more]
gi|768412752|ref|XP_011568467.1|1.104e-9335.94PREDICTED: dentin sialophosphoprotein-like [Plutel... [more]
gi|357626235|gb|EHJ76394.1|1.272e-5832.77hypothetical protein KGM_11189 [Danaus plexippus][more]
gi|827538073|ref|XP_004922373.2|4.521e-4140.74PREDICTED: putative uncharacterized protein DDB_G0... [more]
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 30..51
NoneNo IPR availableCOILSCoilCoilcoord: 292..313
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..19
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..14
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 20..751
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 15..19
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..19
score: 0.533
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..19
score: 0.68
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.922

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13117HiSeq13117Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13117_p ID=HiSeq13117_p|Name=HiSeq13117|organism=Ostrinia scapulalis|type=polypeptide|length=751bp
MRSFLLITLFICLTTIALARPSRLDDRSDISEVEENEYEANEEENAAEDN
VQENEDSRLSDQEAGDTAADEESRNQQPMRFGREKYPQRNYMEEADRPRA
NADGFSECNRGRGKGEKFEETIQANNELPSFSKRRQTNRYIDNSDVNDPP
EKVQHLTNNYKTNRVQGDSRNNEYDKRTIDSQTSSLDDSDAIFDNNRENR
NSGEKVEYNNEVADSSEQSRHFKQYYNTMQSEHKSMLGDKNYEMGNRDRR
QAEASNSINLSSTSTEKEMISAEISNEEDEAAIRRHIKKLSGEELEELLN
SLSDDKKALLNRIIDNDRNAYDTVNKREITKKAGAVEENNYIDSGMSEIS
KVQGGSPSIDINTESAVSQSADLENTKQESQTESVDISTKTADTTRAETP
ESRAELLSEPNDAASNSKLDSSAYDTNDASSSVQSTKTENKRETNVDYFK
NPDGSFDDTQISDNYFNTKDGDDSFNDQGHFCSQDDDLSQLIDEEAQLHN
NEHQYKREIQDNSVDVDDSMKSLEESFPNSNCEENGQYFESNMAPLVRVK
RKDDDLVIKKRAAAVLPDAKVAFFPYKAENDDVDTDEGSEFEDDGFYDRT
SNYAKNDANKPGDNTDTKYGVRSVQSKANVAEDSKPEDSANDKVESDTMS
LGSDTDSVLSGVEGVDDNLMFNSGSRNRRTAEDPEGIDQGRPLRSTPSPE
ENAKLPDSFINVPNYQESDAFGSLPRNYEGELGRYKRIRRVKPPAPSDAT
A
back to top