HiSeq13130_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13130
Unique NameHiSeq13130_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length232
Homology
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|914576817|gb|KOB78630.1| (Antennapedia-like proteinue protein [Operophtera brumata])

HSP 1 Score: 435.261 bits (1118), Expect = 1.260e-152
Identity = 225/237 (94.94%), Postives = 229/237 (96.62%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAYMPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK-SDGYG-PNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSANSCDNMTYFSNAYMPDMRNGG HEHQQAHAHYGAVPQQGHE++GC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK +DGYG PNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMH QQHMV H   PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANSCDNMTYFSNAYMPDMRNGGGHEHQQAHAHYGAVPQQGHELEGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKAADGYGPPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHPQQHMVQHGVPPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 237          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|913325359|ref|XP_013194038.1| (PREDICTED: homeotic protein antennapedia-like [Amyelois transitella] >gi|913325361|ref|XP_013194039.1| PREDICTED: homeotic protein antennapedia-like [Amyelois transitella] >gi|913325363|ref|XP_013194040.1| PREDICTED: homeotic protein antennapedia-like [Amyelois transitella])

HSP 1 Score: 421.779 bits (1083), Expect = 2.200e-147
Identity = 224/235 (95.32%), Postives = 228/235 (97.02%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAYMPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSANSCDNMTYFSN YMPDMRNGG H+HQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK+DGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQ+PHHMH QQHMV H   PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANSCDNMTYFSNGYMPDMRNGGGHDHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKTDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQIPHHMHPQQHMVQHGVPPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 235          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|943952963|ref|XP_014359357.1| (PREDICTED: homeotic protein antennapedia-like [Papilio machaon] >gi|943952965|ref|XP_014359358.1| PREDICTED: homeotic protein antennapedia-like [Papilio machaon] >gi|943952967|ref|XP_014359359.1| PREDICTED: homeotic protein antennapedia-like [Papilio machaon] >gi|943952969|ref|XP_014359360.1| PREDICTED: homeotic protein antennapedia-like [Papilio machaon] >gi|930674096|gb|KPJ14502.1| Homeotic protein antennapedia [Papilio machaon])

HSP 1 Score: 419.468 bits (1077), Expect = 1.774e-146
Identity = 223/234 (95.30%), Postives = 228/234 (97.44%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAY-MPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHVPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSAN+CD+MTYFSNAY MPDMRNGG HEHQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSP+QMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMV H  HQQHLMYPVDDMQHQTQMPPMHQQ+MHAQQ PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANNCDSMTYFSNAYAMPDMRNGGGHEHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPTQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVQHGVHQQHLMYPVDDMQHQTQMPPMHQQAMHAQQ-PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 233          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|827556424|ref|XP_012549565.1| (PREDICTED: antennapedia homologue protein isoform X1 [Bombyx mori] >gi|827556426|ref|XP_012549566.1| PREDICTED: antennapedia homologue protein isoform X1 [Bombyx mori])

HSP 1 Score: 416.001 bits (1068), Expect = 4.231e-145
Identity = 221/235 (94.04%), Postives = 225/235 (95.74%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAYMPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSAN+CD+MTYFSNAYMPDMRNGG HEHQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK+DGYGPNGHQP  PAVYTSCKLQAAAAT G VPGSPPLEQAQQMPHHMH QQHMV H   PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANNCDSMTYFSNAYMPDMRNGGGHEHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKTDGYGPNGHQPATPAVYTSCKLQAAAATGGAVPGSPPLEQAQQMPHHMHPQQHMVQHGVPPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 235          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|357626567|gb|EHJ76618.1| (antennapedia-like proteinue protein [Danaus plexippus])

HSP 1 Score: 406.371 bits (1043), Expect = 2.924e-141
Identity = 216/235 (91.91%), Postives = 223/235 (94.89%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAYMPDMRNGGHEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVY-TSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSAN+CD+MTYFSNAY+PDMRNGGH+HQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHY AQ APGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVY +SCK+QAAAA AGGVPGSPPLEQAQQMPHHMH QQHM  H    HQQHLMYPVDDMQHQTQMPPMHQQSMHAQQ PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANNCDSMTYFSNAYVPDMRNGGHDHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYSAQTAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYPSSCKVQAAAAMAGGVPGSPPLEQAQQMPHHMHPQQHMAQHGMPSHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQAPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 235          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|930657664|gb|KPI99957.1| (Homeotic protein antennapedia [Papilio xuthus])

HSP 1 Score: 403.29 bits (1035), Expect = 2.361e-140
Identity = 209/221 (94.57%), Postives = 212/221 (95.93%), Query Frame = 0
Query:   17 MPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATA----GGVPGSPPLEQAQQMPHHMHAQQHMVPHVPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MPDMRNGG HEHQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSP+QMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATA    GGVPGSPPLEQAQQMPHHMHAQQHMV H  HQQHLMYPVDDMQHQTQMPPMHQQ+MHAQQ PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MPDMRNGGGHEHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPTQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGGVPGSPPLEQAQQMPHHMHAQQHMVQHGVHQQHLMYPVDDMQHQTQMPPMHQQAMHAQQ-PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 220          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|910340763|ref|XP_013174066.1| (PREDICTED: homeotic protein antennapedia-like [Papilio xuthus] >gi|910340765|ref|XP_013174067.1| PREDICTED: homeotic protein antennapedia-like [Papilio xuthus] >gi|910340767|ref|XP_013174068.1| PREDICTED: homeotic protein antennapedia-like [Papilio xuthus] >gi|910340769|ref|XP_013174069.1| PREDICTED: homeotic protein antennapedia-like [Papilio xuthus] >gi|910340771|ref|XP_013174070.1| PREDICTED: homeotic protein antennapedia-like [Papilio xuthus])

HSP 1 Score: 392.504 bits (1007), Expect = 8.671e-136
Identity = 222/238 (93.28%), Postives = 227/238 (95.38%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAY-MPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATA----GGVPGSPPLEQAQQMPHHMHAQQHMVPHVPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSAN+CD+MTYFSNAY MPDMRNGG HEHQQAHAHYGAVPQQGHEMDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSP+ MGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATA    GGVPGSPPLEQAQQMPHHMHAQQHMV H  HQQHLMYPVDDMQHQTQMPPMHQQ+MHAQQ PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANNCDSMTYFSNAYAMPDMRNGGGHEHQQAHAHYGAVPQQGHEMDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPTHMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGGVPGSPPLEQAQQMPHHMHAQQHMVQHGVHQQHLMYPVDDMQHQTQMPPMHQQAMHAQQ-PPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 237          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|112983708|ref|NP_001037319.1| (antennapedia homologue protein [Bombyx mori] >gi|391615|dbj|BAA04087.1| Antennapedia homologue protein [Bombyx mori] >gi|426204115|gb|AFY12623.1| antennapedia-like protein [Bombyx mori])

HSP 1 Score: 329.717 bits (844), Expect = 1.308e-111
Identity = 178/191 (93.19%), Postives = 180/191 (94.24%), Query Frame = 0
Query:   44 MDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MDGC+QQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK+DGYGPNGHQP  PAVYTSCKLQAAAAT G VPGSPPLEQAQQMPHHMH QQHMV H   PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNT  SLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MDGCDQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKTDGYGPNGHQPATPAVYTSCKLQAAAATGGAVPGSPPLEQAQQMPHHMHPQQHMVQHGVPPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTKPSLPSPLYPWMRSQFERKRGRQTYTRYQTL 191          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|768429087|ref|XP_011555709.1| (PREDICTED: homeotic protein antennapedia [Plutella xylostella] >gi|768429089|ref|XP_011555710.1| PREDICTED: homeotic protein antennapedia [Plutella xylostella] >gi|768429091|ref|XP_011555712.1| PREDICTED: homeotic protein antennapedia [Plutella xylostella])

HSP 1 Score: 299.286 bits (765), Expect = 4.641e-99
Identity = 188/235 (80.00%), Postives = 198/235 (84.26%), Query Frame = 0
Query:    1 MSANSCDNMTYFSNAY-MPDMRNGG-HEHQQAHAHYGAVPQQGHEMDGCEQQLRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHM-GPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHVPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MSAN+CD+MTYFSN+Y MPDMRNGG HE  QAHAHYGAVPQQGHE+D C+  LR  QHHYPAQ APGMPYPRFPPYDR+ YYQQM+QNGYRP+SPSQ+ HM G   +GYGPNGHQ PAP VY SCKLQAA   AGGVPGSPPLEQAQQMPHHMH Q        HQQHLMYPVDDMQ QTQM PMHQ  MHAQQ PP QPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MSANNCDSMTYFSNSYNMPDMRNGGGHELAQAHAHYGAVPQQGHELD-CDPGLRAPQHHYPAQTAPGMPYPRFPPYDRMPYYQQMDQNGYRPESPSQLAHMGGKGGEGYGPNGHQAPAPTVYPSCKLQAA---AGGVPGSPPLEQAQQMPHHMHQQHMGH--GVHQQHLMYPVDDMQQQTQM-PMHQAPMHAQQ-PPPQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 227          
BLAST of HiSeq13130 vs. genbank:protein
Match: gi|1142968979|gb|AQM32556.1| (antennapedia [Dendrolimus punctatus])

HSP 1 Score: 296.204 bits (757), Expect = 8.505e-99
Identity = 161/169 (95.27%), Postives = 162/169 (95.86%), Query Frame = 0
Query:   66 MPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHMHAQQHMVPHV--PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 232
            MPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPK+DGYGPNGHQPP PAVYTSCKLQAAAATAGGVPGSPPLEQAQQM HHMH QQHMV H   PHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
Sbjct:    1 MPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMGPKTDGYGPNGHQPPTPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMTHHMHPQQHMVQHGVPPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPNTNASLPSPLYPWMRSQFERKRGRQTYTRYQTL 169          
The following BLAST results are available for this feature:
BLAST of HiSeq13130 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914576817|gb|KOB78630.1|1.260e-15294.94Antennapedia-like proteinue protein [Operophtera b... [more]
gi|913325359|ref|XP_013194038.1|2.200e-14795.32PREDICTED: homeotic protein antennapedia-like [Amy... [more]
gi|943952963|ref|XP_014359357.1|1.774e-14695.30PREDICTED: homeotic protein antennapedia-like [Pap... [more]
gi|827556424|ref|XP_012549565.1|4.231e-14594.04PREDICTED: antennapedia homologue protein isoform ... [more]
gi|357626567|gb|EHJ76618.1|2.924e-14191.91antennapedia-like proteinue protein [Danaus plexip... [more]
gi|930657664|gb|KPI99957.1|2.361e-14094.57Homeotic protein antennapedia [Papilio xuthus][more]
gi|910340763|ref|XP_013174066.1|8.671e-13693.28PREDICTED: homeotic protein antennapedia-like [Pap... [more]
gi|112983708|ref|NP_001037319.1|1.308e-11193.19antennapedia homologue protein [Bombyx mori] >gi|3... [more]
gi|768429087|ref|XP_011555709.1|4.641e-9980.00PREDICTED: homeotic protein antennapedia [Plutella... [more]
gi|1142968979|gb|AQM32556.1|8.505e-9995.27antennapedia [Dendrolimus punctatus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007275 multicellular organism development
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR24326FAMILY NOT NAMEDcoord: 56..99
NoneNo IPR availablePANTHERPTHR24326:SF169HOMEOTIC PROTEIN ANTENNAPEDIAcoord: 141..232
NoneNo IPR availablePANTHERPTHR24326:SF169HOMEOTIC PROTEIN ANTENNAPEDIAcoord: 56..99
NoneNo IPR availablePANTHERPTHR24326FAMILY NOT NAMEDcoord: 141..232
IPR001827Homeobox protein, antennapedia type, conserved sitePROSITEPS00032ANTENNAPEDIAcoord: 209..214

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13130HiSeq13130Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13130_p ID=HiSeq13130_p|Name=HiSeq13130|organism=Ostrinia scapulalis|type=polypeptide|length=232bp
MSANSCDNMTYFSNAYMPDMRNGGHEHQQAHAHYGAVPQQGHEMDGCEQQ
LRPAQHHYPAQPAPGMPYPRFPPYDRLGYYQQMEQNGYRPDSPSQMGHMG
PKSDGYGPNGHQPPAPAVYTSCKLQAAAATAGGVPGSPPLEQAQQMPHHM
HAQQHMVPHVPHQQHLMYPVDDMQHQTQMPPMHQQSMHAQQPPPQQPPPN
TNASLPSPLYPWMRSQFERKRGRQTYTRYQTL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0007275multicellular organism development
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR001827Homeobox_Antennapedia_CS