HiSeq13134_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13134
Unique NameHiSeq13134_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length63
Homology
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|21362850|sp|Q8WQI7.1|RL18A_SPOFR (RecName: Full=60S ribosomal protein L18a >gi|18253051|gb|AAL62470.1| ribosomal protein L18A [Spodoptera frugiperda])

HSP 1 Score: 124.405 bits (311), Expect = 9.106e-35
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKASACRRPQVKQFH S I+FPLPKRVHHHKRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHNSTIRFPLPKRVHHHKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|914095794|ref|NP_001298543.1| (60S ribosomal protein L18a [Papilio polytes] >gi|914615653|ref|NP_001298729.1| 60S ribosomal protein L18a [Papilio xuthus] >gi|943935480|ref|XP_014362062.1| PREDICTED: 60S ribosomal protein L18a [Papilio machaon] >gi|389608215|dbj|BAM17719.1| ribosomal protein L18A [Papilio xuthus] >gi|389611131|dbj|BAM19177.1| ribosomal protein L18A [Papilio polytes] >gi|930662516|gb|KPJ04296.1| 60S ribosomal protein L18a [Papilio xuthus] >gi|930680096|gb|KPJ19862.1| 60S ribosomal protein L18a [Papilio machaon])

HSP 1 Score: 123.25 bits (308), Expect = 2.567e-34
Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSI IIKVEVIKASACRRPQVKQFH S IKFPLPKRVHHHKRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIHIIKVEVIKASACRRPQVKQFHNSGIKFPLPKRVHHHKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|913298599|ref|XP_013192968.1| (PREDICTED: 60S ribosomal protein L18a [Amyelois transitella])

HSP 1 Score: 122.865 bits (307), Expect = 3.928e-34
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKASACRRPQVKQFH S I+FPLPKRVHHHKRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHNSHIRFPLPKRVHHHKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|1073541479|gb|JAT87851.1| (hypothetical protein g.16613 [Pectinophora gossypiella])

HSP 1 Score: 122.865 bits (307), Expect = 3.971e-34
Identity = 59/63 (93.65%), Postives = 61/63 (96.83%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKASACRRPQVKQFH S I+FPLPKRVHH+KRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHNSTIRFPLPKRVHHYKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|509177059|gb|JAA86650.1| (ribosomal protein L18A [Pararge aegeria])

HSP 1 Score: 122.865 bits (307), Expect = 4.333e-34
Identity = 58/63 (92.06%), Postives = 61/63 (96.83%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVE+IKA+ACRRPQVKQFH S IKFPLPKRVHH+KRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEIIKAAACRRPQVKQFHNSGIKFPLPKRVHHYKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|342356467|gb|AEL28892.1| (ribosomal protein L18A [Heliconius melpomene cythera])

HSP 1 Score: 122.094 bits (305), Expect = 8.708e-34
Identity = 58/63 (92.06%), Postives = 62/63 (98.41%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKA+ACRRPQVKQFH S+I+FPLPKRVHH+KRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKAAACRRPQVKQFHNSSIRFPLPKRVHHYKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|357607882|gb|EHJ65723.1| (ribosomal protein L18A [Danaus plexippus])

HSP 1 Score: 121.709 bits (304), Expect = 1.048e-33
Identity = 58/63 (92.06%), Postives = 62/63 (98.41%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKA+ACRRPQVKQFH S+I+FPLPKRVHH+KRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKAAACRRPQVKQFHNSSIRFPLPKRVHHYKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|112984310|ref|NP_001037219.1| (ribosomal protein L18A [Bombyx mori] >gi|54609229|gb|AAV34830.1| ribosomal protein L18A [Bombyx mori])

HSP 1 Score: 121.324 bits (303), Expect = 1.587e-33
Identity = 58/63 (92.06%), Postives = 61/63 (96.83%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSIQIIKVEVIKA+ACRRPQVKQFH S I+FPLPKRVHH+KRLNTFAYKRPSTYFL
Sbjct:  115 ARHRARAHSIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNTFAYKRPSTYFL 177          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|768448363|ref|XP_011566207.1| (PREDICTED: 60S ribosomal protein L18a-like [Plutella xylostella])

HSP 1 Score: 119.013 bits (297), Expect = 5.772e-33
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSI IIKVEVIKASACRRPQVKQFH S I+FPLPKRVHHHKRLN FAYKRPSTYFL
Sbjct:   82 ARHRARAHSIHIIKVEVIKASACRRPQVKQFHNSTIRFPLPKRVHHHKRLNKFAYKRPSTYFL 144          
BLAST of HiSeq13134 vs. genbank:protein
Match: gi|768445381|ref|XP_011564585.1| (PREDICTED: 60S ribosomal protein L18a-like [Plutella xylostella])

HSP 1 Score: 118.627 bits (296), Expect = 8.479e-33
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 0
Query:    1 ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRLNTFAYKRPSTYFL 63
            ARHRARAHSI IIKVEVIKASACRRPQVKQFH S I+FPLPKRVHHHKRLN FAYKRPSTYFL
Sbjct:   87 ARHRARAHSIHIIKVEVIKASACRRPQVKQFHNSTIRFPLPKRVHHHKRLNKFAYKRPSTYFL 149          
The following BLAST results are available for this feature:
BLAST of HiSeq13134 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|21362850|sp|Q8WQI7.1|RL18A_SPOFR9.106e-3595.24RecName: Full=60S ribosomal protein L18a >gi|18253... [more]
gi|914095794|ref|NP_001298543.1|2.567e-3495.2460S ribosomal protein L18a [Papilio polytes] >gi|9... [more]
gi|913298599|ref|XP_013192968.1|3.928e-3495.24PREDICTED: 60S ribosomal protein L18a [Amyelois tr... [more]
gi|1073541479|gb|JAT87851.1|3.971e-3493.65hypothetical protein g.16613 [Pectinophora gossypi... [more]
gi|509177059|gb|JAA86650.1|4.333e-3492.06ribosomal protein L18A [Pararge aegeria][more]
gi|342356467|gb|AEL28892.1|8.708e-3492.06ribosomal protein L18A [Heliconius melpomene cythe... [more]
gi|357607882|gb|EHJ65723.1|1.048e-3392.06ribosomal protein L18A [Danaus plexippus][more]
gi|112984310|ref|NP_001037219.1|1.587e-3392.06ribosomal protein L18A [Bombyx mori] >gi|54609229|... [more]
gi|768448363|ref|XP_011566207.1|5.772e-3392.06PREDICTED: 60S ribosomal protein L18a-like [Plutel... [more]
gi|768445381|ref|XP_011564585.1|8.479e-3392.06PREDICTED: 60S ribosomal protein L18a-like [Plutel... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
cellular_component GO:0005840 ribosome
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR1005260S RIBOSOMAL PROTEIN L18Acoord: 1..63
NoneNo IPR availableSUPERFAMILY160374RplX-likecoord: 1..32

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13134HiSeq13134Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13134_p ID=HiSeq13134_p|Name=HiSeq13134|organism=Ostrinia scapulalis|type=polypeptide|length=63bp
ARHRARAHSIQIIKVEVIKASACRRPQVKQFHASAIKFPLPKRVHHHKRL
NTFAYKRPSTYFL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Cellular Component
TermDefinition
GO:0005840ribosome