HiSeq13135_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13135
Unique NameHiSeq13135_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length122
Homology
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|315115479|gb|ADT80712.1| (ribosomal protein L18A [Euphydryas aurinia])

HSP 1 Score: 253.062 bits (645), Expect = 1.420e-84
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|1073541479|gb|JAT87851.1| (hypothetical protein g.16613 [Pectinophora gossypiella])

HSP 1 Score: 252.292 bits (643), Expect = 3.127e-84
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGEL+EYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELREYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|342356467|gb|AEL28892.1| (ribosomal protein L18A [Heliconius melpomene cythera])

HSP 1 Score: 252.292 bits (643), Expect = 3.768e-84
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRKLPS+SEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKLPSDSEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|913298599|ref|XP_013192968.1| (PREDICTED: 60S ribosomal protein L18a [Amyelois transitella])

HSP 1 Score: 252.292 bits (643), Expect = 3.852e-84
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKE+EVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEFEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|21362850|sp|Q8WQI7.1|RL18A_SPOFR (RecName: Full=60S ribosomal protein L18a >gi|18253051|gb|AAL62470.1| ribosomal protein L18A [Spodoptera frugiperda])

HSP 1 Score: 249.595 bits (636), Expect = 4.395e-83
Identity = 120/122 (98.36%), Postives = 121/122 (99.18%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPD IVAKSRFWYFLRQLKKFKKTTGEIVSI+EIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDQIVAKSRFWYFLRQLKKFKKTTGEIVSIREIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|914095794|ref|NP_001298543.1| (60S ribosomal protein L18a [Papilio polytes] >gi|914615653|ref|NP_001298729.1| 60S ribosomal protein L18a [Papilio xuthus] >gi|943935480|ref|XP_014362062.1| PREDICTED: 60S ribosomal protein L18a [Papilio machaon] >gi|389608215|dbj|BAM17719.1| ribosomal protein L18A [Papilio xuthus] >gi|389611131|dbj|BAM19177.1| ribosomal protein L18A [Papilio polytes] >gi|930662516|gb|KPJ04296.1| 60S ribosomal protein L18a [Papilio xuthus] >gi|930680096|gb|KPJ19862.1| 60S ribosomal protein L18a [Papilio machaon])

HSP 1 Score: 248.825 bits (634), Expect = 7.199e-83
Identity = 119/122 (97.54%), Postives = 121/122 (99.18%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRK PS+SEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSP+KIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKQPSDSEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPIKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|112984310|ref|NP_001037219.1| (ribosomal protein L18A [Bombyx mori] >gi|54609229|gb|AAV34830.1| ribosomal protein L18A [Bombyx mori])

HSP 1 Score: 248.44 bits (633), Expect = 9.680e-83
Identity = 117/122 (95.90%), Postives = 122/122 (100.00%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKG+L+EYEVIGRKLPSE+EPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSP+KIKNFGIWLRYESRSGVHNMYREYRDLS+GGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGQLREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPIKIKNFGIWLRYESRSGVHNMYREYRDLSLGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|770075639|ref|NP_001292407.1| (60S ribosomal protein L18a [Plutella xylostella] >gi|49532908|dbj|BAD26689.1| Ribosomal protein L18A [Plutella xylostella])

HSP 1 Score: 247.669 bits (631), Expect = 1.974e-82
Identity = 118/122 (96.72%), Postives = 121/122 (99.18%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRKL SE+EPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSI+EIPEKSP+KIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKLASEAEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIREIPEKSPIKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|509177059|gb|JAA86650.1| (ribosomal protein L18A [Pararge aegeria])

HSP 1 Score: 246.899 bits (629), Expect = 5.415e-82
Identity = 116/122 (95.08%), Postives = 121/122 (99.18%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGEL+EYEVIGRKLP+++EP PPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVK+KNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELREYEVIGRKLPTDNEPTPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKVKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
BLAST of HiSeq13135 vs. genbank:protein
Match: gi|268306484|gb|ACY95363.1| (ribosomal protein L18A [Manduca sexta])

HSP 1 Score: 246.514 bits (628), Expect = 5.596e-82
Identity = 118/122 (96.72%), Postives = 120/122 (98.36%), Query Frame = 0
Query:    1 MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122
            MKAKGELKEYEVIGRKLPS SEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKK TGEIVSI+EIPEKSP+KIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH
Sbjct:    1 MKAKGELKEYEVIGRKLPSGSEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKATGEIVSIREIPEKSPIKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAH 122          
The following BLAST results are available for this feature:
BLAST of HiSeq13135 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|315115479|gb|ADT80712.1|1.420e-84100.00ribosomal protein L18A [Euphydryas aurinia][more]
gi|1073541479|gb|JAT87851.1|3.127e-8499.18hypothetical protein g.16613 [Pectinophora gossypi... [more]
gi|342356467|gb|AEL28892.1|3.768e-8499.18ribosomal protein L18A [Heliconius melpomene cythe... [more]
gi|913298599|ref|XP_013192968.1|3.852e-8499.18PREDICTED: 60S ribosomal protein L18a [Amyelois tr... [more]
gi|21362850|sp|Q8WQI7.1|RL18A_SPOFR4.395e-8398.36RecName: Full=60S ribosomal protein L18a >gi|18253... [more]
gi|914095794|ref|NP_001298543.1|7.199e-8397.5460S ribosomal protein L18a [Papilio polytes] >gi|9... [more]
gi|112984310|ref|NP_001037219.1|9.680e-8395.90ribosomal protein L18A [Bombyx mori] >gi|54609229|... [more]
gi|770075639|ref|NP_001292407.1|1.974e-8296.7260S ribosomal protein L18a [Plutella xylostella] >... [more]
gi|509177059|gb|JAA86650.1|5.415e-8295.08ribosomal protein L18A [Pararge aegeria][more]
gi|268306484|gb|ACY95363.1|5.596e-8296.72ribosomal protein L18A [Manduca sexta][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
cellular_component GO:0005840 ribosome
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023573Ribosomal protein L18a/LXPFAMPF01775Ribosomal_L18aecoord: 7..121
e-value: 6.9E-52
score: 174.4
NoneNo IPR availablePANTHERPTHR10052:SF160S RIBOSOMAL PROTEIN L18Acoord: 1..122
NoneNo IPR availablePANTHERPTHR1005260S RIBOSOMAL PROTEIN L18Acoord: 1..122
NoneNo IPR availableSUPERFAMILY160374RplX-likecoord: 72..121
IPR02887750S ribosomal protein L18Ae/60S ribosomal protein L20 and L18aHAMAPMF_00273Ribosomal_L18Aecoord: 30..122
score: 32.277

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13135HiSeq13135Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13135_p ID=HiSeq13135_p|Name=HiSeq13135|organism=Ostrinia scapulalis|type=polypeptide|length=122bp
MKAKGELKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQ
LKKFKKTTGEIVSIKEIPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDL
SVGGAVTQCYRDMGARHRARAH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005840ribosome
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR02887750S_L18Ae/Ribosomal_L18a/L20
IPR023573Ribosomal_L18a/LX