HiSeq13141_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13141
Unique NameHiSeq13141_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length323
Homology
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|943963813|ref|XP_014364186.1| (PREDICTED: probable methyltransferase BTM2 homolog [Papilio machaon] >gi|930669926|gb|KPJ10789.1| UPF0532 protein CG3570 [Papilio machaon])

HSP 1 Score: 426.402 bits (1095), Expect = 3.367e-147
Identity = 195/326 (59.82%), Postives = 253/326 (77.61%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF---NEDPDESLLDKG-------VQSDIKDFQELPFCF 322
            MA+EEHKELA Y+K VH++LRK+S+K G  RAWL+HC N+ +L+ YA CME+LAT HW +NC   ++   SRIQW+AD+C++Y++N+ Y++F+ +E +I++KIN+  D  E FS P+  LDVGSCYNPFK+Y +L+V  IDLCPANNSV QCDFLNV++G ETII +  +KQ+  +S+++V FC+LLEYIP+S LRI AC +AY+LLK GG+LIINTPDSKHVGANSKLMKCWRYTLAC+GF RIKYEKFKHMHC+ FRK+LHKD+AIRW T+ KE  MEY + IPQDF    E+ D + LDK          +  + F ELPF +
Sbjct:    1 MATEEHKELAYYIKEVHASLRKSSSKIGFRRAWLEHCKNESILKKYAKCMERLATVHWDSNCLDKSNAVVSRIQWSADYCYNYYINEHYLKFRDREIDISQKININIDTSEQFSLPLKLLDVGSCYNPFKMYTFLDVLPIDLCPANNSVYQCDFLNVVIGKETIIESQNIKQLEQNSYDIVTFCFLLEYIPNSELRIEACVRAYNLLKSGGILIINTPDSKHVGANSKLMKCWRYTLACLGFSRIKYEKFKHMHCLVFRKSLHKDIAIRWTTLCKEPIMEYGLFIPQDFLSEKEEDDHTNLDKASIICNNDSATITEHFDELPFSY 326          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|1073544577|gb|JAT89400.1| (hypothetical protein g.787 [Pectinophora gossypiella] >gi|1073544605|gb|JAT89414.1| hypothetical protein g.789 [Pectinophora gossypiella])

HSP 1 Score: 421.779 bits (1083), Expect = 1.424e-145
Identity = 194/314 (61.78%), Postives = 247/314 (78.66%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDFNEDPDESLLDKGVQSDIKDFQELPF 320
            MASEEHK+LA +LKNVH  LRKAS K G++ AW  HC NKDVL+ YA CMEKLATTHWT +   + S  TSRI W A+FC+DYF+NK Y+  + K+  I+EKIN+  D DE  S P+  +DVGSCYNPF+ Y++ +V AIDL PANNSVLQCDFL VL G  T I++ +V Q++   F+VV FC+LLEYIP S LRI AC+KAY+++K GGLLIINTPDSKHVGANSK+MKCW+YTLA IGF RIKYEKFKHMHCMAFRK   KD+A RWA++H++  M+YA++IPQDFN++ +E++  + ++ +++DF ELPF
Sbjct:    1 MASEEHKQLAHFLKNVHLCLRKASTKEGAEEAWRQHCENKDVLKHYAQCMEKLATTHWTASTTREHSSVTSRITWAAEFCYDYFINKGYISHRQKDIEISEKINITCDVDECHSQPIKLIDVGSCYNPFQCYDFFDVTAIDLYPANNSVLQCDFLKVLTGHNTKISDMKVDQIQEKYFDVVTFCFLLEYIPTSELRIKACEKAYNIVKYGGLLIINTPDSKHVGANSKIMKCWQYTLANIGFTRIKYEKFKHMHCMAFRKASCKDIAQRWASLHRKPYMQYALHIPQDFNDNTEETIYSQEIKIEVEDFMELPF 314          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|930651881|gb|KPI94223.1| (UPF0532 protein CG3570 [Papilio xuthus])

HSP 1 Score: 420.624 bits (1080), Expect = 5.449e-145
Identity = 192/326 (58.90%), Postives = 251/326 (76.99%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF---NEDPDESLLDKGVQ-------SDIKDFQELPFCF 322
            MA+EEHKELA Y+K VH++LRK+S+K G  RAWL+H  N+D+L+ YA CME+LAT HW +NC   ++   SRIQW+ADF ++Y++N  Y++F+ ++ +I+ KIN+  D  E FS P+  LDVGSCYNPFK+Y +L+V  IDLCPANNSV QCDFLNV +G E +I +  +K++  +SF++V FC+LLEYIP+S LRI AC +AY+LLKPGG+LIINTPDSKHVGANSKLMKCWRYTLAC+GF RIKYEKFKHMHC+ FRK+LHKD+AIRW+T+ KE  MEY + IPQDF    E+ D + +DK          +  + F+ELPF +
Sbjct:    1 MATEEHKELAYYIKEVHASLRKSSSKIGFRRAWLEHSKNEDILKKYAKCMERLATVHWDSNCLDKSNAVVSRIQWSADFSYNYYINDHYLKFRDRDIDISNKINISIDSLEQFSLPLKLLDVGSCYNPFKMYTFLDVLPIDLCPANNSVYQCDFLNVDIGEEMVIESQSIKELEQNSFDIVTFCFLLEYIPNSELRIEACVRAYNLLKPGGILIINTPDSKHVGANSKLMKCWRYTLACLGFSRIKYEKFKHMHCLVFRKSLHKDIAIRWSTLCKESNMEYGLFIPQDFLSDKEEDDHTNIDKASNICNNDSATITEHFEELPFSY 326          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|910325570|ref|XP_013165910.1| (PREDICTED: probable methyltransferase BTM2 homolog [Papilio xuthus])

HSP 1 Score: 416.772 bits (1070), Expect = 2.035e-143
Identity = 191/326 (58.59%), Postives = 250/326 (76.69%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF---NEDPDESLLDKGVQ-------SDIKDFQELPFCF 322
            MA+EEHKELA Y+K VH++LRK+S+K G  RAWL+H  N+D+L+ YA CME+LAT HW +NC   ++   SRIQW+ADF ++Y++N  Y++F+ ++ +I+ KIN+  D  E FS P+  LDVGSCYNPFK+Y +L+V  IDLCPANNSV Q DFLNV +G E +I +  +K++  +SF++V FC+LLEYIP+S LRI AC +AY+LLKPGG+LIINTPDSKHVGANSKLMKCWRYTLAC+GF RIKYEKFKHMHC+ FRK+LHKD+AIRW+T+ KE  MEY + IPQDF    E+ D + +DK          +  + F+ELPF +
Sbjct:    1 MATEEHKELAYYIKEVHASLRKSSSKIGFRRAWLEHSKNEDILKKYAKCMERLATVHWDSNCLDKSNAVVSRIQWSADFSYNYYINDHYLKFRDRDIDISNKINISIDSLEQFSLPLKLLDVGSCYNPFKMYTFLDVLPIDLCPANNSVYQFDFLNVDIGEEMVIESQSIKELEQNSFDIVTFCFLLEYIPNSELRIEACVRAYNLLKPGGILIINTPDSKHVGANSKLMKCWRYTLACLGFSRIKYEKFKHMHCLVFRKSLHKDIAIRWSTLCKESNMEYGLFIPQDFLSDKEEDDHTNIDKASNICNNDSATITEHFEELPFSY 326          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|909568309|ref|XP_013139599.1| (PREDICTED: probable methyltransferase BTM2 homolog [Papilio polytes])

HSP 1 Score: 414.846 bits (1065), Expect = 9.124e-143
Identity = 196/322 (60.87%), Postives = 248/322 (77.02%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDFNED-------PDESLLDKGVQSDIKD-FQELPF 320
            MA+EEHKELA Y+K VH++LRK+S+K G  RAWL+HC N+DVL+ YA CME+LAT HW  NC  D S   SRIQW+ADFC++Y++N+QY++F+ KE +I+ KI++  D  E F+ P+  LDVGSCYNPFK YEYL+V AIDLCPANNSV QCDFLNV +  E II N  + Q+  +S+++V FC+LLEYIP+S LRI AC +AY+LLK GG+LIINTPDSKHVGANS+LMKCWRYTLAC+GF RIKYEKFKHMHC+ FRK+LHKD+A RW  + KE  +EY + IPQDF  D       PD++ +     ++I + F ELPF
Sbjct:    1 MATEEHKELAYYIKEVHASLRKSSSKIGFHRAWLEHCENEDVLKKYAKCMERLATVHWDNNCL-DKSHVVSRIQWSADFCYNYYINEQYVKFREKEIDISNKIDINIDSIEQFTLPLKLLDVGSCYNPFKNYEYLDVLAIDLCPANNSVYQCDFLNVGIDKEIIIENHRINQLEENSYDIVTFCFLLEYIPNSELRIEACVRAYNLLKLGGILIINTPDSKHVGANSRLMKCWRYTLACLGFSRIKYEKFKHMHCLVFRKSLHKDIAKRWTLLCKEPNIEYGLFIPQDFLSDKEENQTNPDKTSIHVTNSANITEYFVELPF 321          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|913310806|ref|XP_013186058.1| (PREDICTED: probable methyltransferase BTM2 homolog [Amyelois transitella])

HSP 1 Score: 405.986 bits (1042), Expect = 2.346e-139
Identity = 194/317 (61.20%), Postives = 238/317 (75.08%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF---NEDPDESLLDKGVQSDIKDFQELPF 320
            MASEEHK LA +LK+VHS+LRK+S + G++ AW  HC NKDVL  YA CM+KLAT HW  N A++ + ATSRI W    C +YF  K Y +F+ KE +IA K+ +   + E F+ P+  +DVGSCYNPF++Y+  NVFAIDLCP+N+SV QCDFL V  G + ++ N +V Q++S  F+VV FC+LLEYIP S  RI AC+KAY +LKPGGLLIINTPDSKHVGAN K+MKCWRY LAC+GF RIKYEKFKHMHCMAFRK L+KD A+RWAT++KE  MEYA+NIPQDF   NED    LL+  VQ    DF ELPF
Sbjct:    3 MASEEHKLLAQFLKDVHSSLRKSSTELGAEEAWRKHCDNKDVLTKYASCMQKLATNHWDVNYANNVT-ATSRITWAFQTCREYFFEKAYFKFRQKEIDIATKLGVTVTQQELFTKPLQLIDVGSCYNPFQIYDCFNVFAIDLCPSNDSVFQCDFLKVATGNDNLVQNNKVMQLKSCFFDVVTFCFLLEYIPSSEFRINACEKAYHILKPGGLLIINTPDSKHVGANCKIMKCWRYALACMGFTRIKYEKFKHMHCMAFRKALNKDTAVRWATLYKEPYMEYAMNIPQDFQKENEDTKVVLLN-DVQPSHCDFTELPF 317          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|768437348|ref|XP_011560210.1| (PREDICTED: probable methyltransferase BTM2 homolog [Plutella xylostella])

HSP 1 Score: 394.045 bits (1011), Expect = 7.343e-135
Identity = 183/288 (63.54%), Postives = 224/288 (77.78%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQD 294
            MAS+EHK LA +LK+VHS+LR++S+K G+ RAW +HC  KDVLE YA CMEKLAT HW  N +   S A SRI+WT D C DYF+NK Y     KE  IAEKIN+  D+ E F  P+  LDVGSCY+PFK Y++++V AIDLCPAN+SV+QCDFLNV +G E  I   +V +++ +S+EVV FC++LEYIP   LRI AC+KAY LLKPGGLLIINTPDSKHVGAN K+MKCWRY LA +GF RIKYEKF HMHCM FRK+L KD A+RWAT+HK+  MEY+++IPQD
Sbjct:    1 MASDEHKSLAQFLKDVHSSLRQSSSKIGAKRAWSEHCEQKDVLEKYARCMEKLATEHWDVNSSKSDSTAVSRIKWTTDECQDYFINKGYQSCHEKETVIAEKINVKFDQKELFDIPIRLLDVGSCYSPFKDYDFIDVLAIDLCPANSSVMQCDFLNVNIGKELSICENKVVELQENSYEVVTFCFVLEYIPTPELRISACEKAYRLLKPGGLLIINTPDSKHVGANCKIMKCWRYALALMGFSRIKYEKFAHMHCMTFRKSLVKDTAVRWATLHKQEYMEYSLHIPQD 288          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|914567201|gb|KOB71542.1| (putative methyltransferase BTM2 [Operophtera brumata])

HSP 1 Score: 393.275 bits (1009), Expect = 1.635e-134
Identity = 181/289 (62.63%), Postives = 235/289 (81.31%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF 295
            MA+++H+ L  Y+K VHS+LRK +++ G+++AW +HC N D+L  YA  M++LATTHW  NCAS++S A+SRI+WTA +C  YF+N++Y+ ++ KE+ IA K+NL  +  E FS P+  +DVGSCYNPF+ YE  +V AIDLCPAN+SVLQCDFL+VL+G +T I   +V Q++  S ++V FC+LLEYIP S+LRI AC++AYSLL+PGGLLIINTPDSKHVGANSKLMKCWRYTLA IGF RIKYEKFKHMHCMAFRK+LHKD+A RWA +H+E  M++AI IPQDF
Sbjct:    1 MANQDHQSLTQYIKGVHSSLRKTTSELGAEKAWYEHCKNHDILLKYADYMQRLATTHWENNCASESSEASSRIEWTAKYCTHYFINQEYVTYREKEQAIASKLNLNLEIKEIFSEPLKIIDVGSCYNPFRRYENFDVLAIDLCPANDSVLQCDFLSVLIGTQTTIEGSKVVQLQHKSSDIVTFCFLLEYIPSSDLRISACERAYSLLRPGGLLIINTPDSKHVGANSKLMKCWRYTLAQIGFNRIKYEKFKHMHCMAFRKSLHKDIAARWAKLHEEPFMKFAIQIPQDF 289          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|512927400|ref|XP_004931325.1| (PREDICTED: probable methyltransferase BTM2 homolog [Bombyx mori])

HSP 1 Score: 393.275 bits (1009), Expect = 1.913e-134
Identity = 185/316 (58.54%), Postives = 235/316 (74.37%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDF--NEDPDESLLDKGVQSDIKDFQELPF 320
            MASEE K L+++LK+VHS LR ++++ G ++AW  H  N ++L+ YA CMEKLATT+W      + S   SRI WTA  C++YF+NK Y+ ++ +E+NIA K+ L  +  E FS  +  +DVGSCYNPFK+Y Y +VFAIDLCPAN SVLQCDFL+  +G  T+I + +VK++  +S+E V FC+LLEYIP S LRI ACQKAY +LKPGGLL + TPDSKHVGANSK MKCWRY LA +GF RI+Y+KF+HMHCMAFRK L KDVAIRWA IHKE  MEYA++IPQDF  NE    S  ++ +   I DFQELPF
Sbjct:    1 MASEEQKALSTFLKDVHSALRNSTSQIGVEKAWKAHSKNTEILKKYAQCMEKLATTYW------EHSETISRIDWTAKICYEYFINKTYLHYREQEQNIANKMQLKLNTVESFSEVLKLVDVGSCYNPFKLYNYFDVFAIDLCPANESVLQCDFLDTPIGTRTVIEDNKVKEIGENSYESVTFCFLLEYIPTSQLRITACQKAYDILKPGGLLTVTTPDSKHVGANSKTMKCWRYALALMGFSRIRYQKFQHMHCMAFRKCLLKDVAIRWANIHKEPFMEYALHIPQDFNTNEISKNSAQNQVIHHIIDDFQELPF 310          
BLAST of HiSeq13141 vs. genbank:protein
Match: gi|357623079|gb|EHJ74377.1| (hypothetical protein KGM_03626 [Danaus plexippus])

HSP 1 Score: 389.808 bits (1000), Expect = 4.832e-133
Identity = 185/314 (58.92%), Postives = 241/314 (76.75%), Query Frame = 0
Query:    7 MASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLETYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKAKERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCPANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSNLRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMRIKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDFNEDPDESLLDKGVQSDIKDFQELPF 320
            MAS+EH ELA YLKNVH++LRK S   G+++AW++HC NK+VL  YA CM+KLAT HW  N  ++ S A SRI+WT+DFC +YF N   +  + ++  IA KIN++ ++++    P   LDVGSCYNPF++Y++L+V AIDLCPAN SV QCDFLN+  G ETII N  V  +  +SF+VV FC+LLEYIP S  RI AC  AY LLK GGLLIINTPDSKHVGANSK+MKCWRYTLACIGF R+KYEKF+H+HCMAFRK+L+K++A+RWATIH+E  M++ I IPQD+ +  +++  +K +  D++DF ELPF
Sbjct:    1 MASDEHIELAQYLKNVHTSLRKLSLNIGAEKAWIEHCNNKEVLNKYAQCMQKLATVHWDPNSNNENSEAFSRIKWTSDFCEEYFTNICSVHSR-RDMEIAMKINVILNKEQPCHKPYKLLDVGSCYNPFQIYDFLDVLAIDLCPANESVKQCDFLNICFGNETIIKNNGVTHLVKNSFDVVTFCFLLEYIPSSEQRIKACLNAYKLLKFGGLLIINTPDSKHVGANSKIMKCWRYTLACIGFSRVKYEKFRHIHCMAFRKSLNKEIAVRWATIHREPYMDFKIQIPQDYLKIKNDNNSEK-ITVDLEDFGELPF 312          
The following BLAST results are available for this feature:
BLAST of HiSeq13141 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943963813|ref|XP_014364186.1|3.367e-14759.82PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|1073544577|gb|JAT89400.1|1.424e-14561.78hypothetical protein g.787 [Pectinophora gossypiel... [more]
gi|930651881|gb|KPI94223.1|5.449e-14558.90UPF0532 protein CG3570 [Papilio xuthus][more]
gi|910325570|ref|XP_013165910.1|2.035e-14358.59PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|909568309|ref|XP_013139599.1|9.124e-14360.87PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|913310806|ref|XP_013186058.1|2.346e-13961.20PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|768437348|ref|XP_011560210.1|7.343e-13563.54PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|914567201|gb|KOB71542.1|1.635e-13462.63putative methyltransferase BTM2 [Operophtera bruma... [more]
gi|512927400|ref|XP_004931325.1|1.913e-13458.54PREDICTED: probable methyltransferase BTM2 homolog... [more]
gi|357623079|gb|EHJ74377.1|4.832e-13358.92hypothetical protein KGM_03626 [Danaus plexippus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0031167 rRNA methylation
molecular_function GO:0016433 rRNA (adenine) methyltransferase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR02186725S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2PFAMPF11968DUF3321coord: 106..219
e-value: 2.4E-5
score: 23.9
IPR02186725S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2HAMAPMF_03044BMT2coord: 8..301
score: 19.752
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseGENE3D3.40.50.150coord: 124..255
e-value: 6.3E-8
score: 31.6
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILY53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 95..236
NoneNo IPR availablePANTHERPTHR21008UNCHARACTERIZEDcoord: 7..305

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13141HiSeq13141Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13141_p ID=HiSeq13141_p|Name=HiSeq13141|organism=Ostrinia scapulalis|type=polypeptide|length=323bp
MVLSSTMASEEHKELASYLKNVHSTLRKASAKNGSDRAWLDHCANKDVLE
TYAHCMEKLATTHWTTNCASDTSGATSRIQWTADFCFDYFLNKQYMRFKA
KERNIAEKINLVQDEDEHFSNPVHFLDVGSCYNPFKVYEYLNVFAIDLCP
ANNSVLQCDFLNVLVGAETIINNCEVKQMRSSSFEVVAFCYLLEYIPDSN
LRILACQKAYSLLKPGGLLIINTPDSKHVGANSKLMKCWRYTLACIGFMR
IKYEKFKHMHCMAFRKTLHKDVAIRWATIHKELGMEYAINIPQDFNEDPD
ESLLDKGVQSDIKDFQELPFCFG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0031167rRNA methylation
Vocabulary: Molecular Function
TermDefinition
GO:0016433rRNA (adenine) methyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR029063SAM-dependent_MTases
IPR021867Bmt2