HiSeq13148_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13148
Unique NameHiSeq13148_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length256
Homology
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|209395384|gb|ACI45418.1| (serine proteinase diverged [Ostrinia nubilalis])

HSP 1 Score: 502.671 bits (1293), Expect = 4.931e-179
Identity = 250/255 (98.04%), Postives = 253/255 (99.22%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQLPGGDDSGDSDENGDDSDDNG 256
            MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGG LNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGAD DGAAGEFLSCVDADVS+DDDGVISADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQLPGG+DSGDSD+NGDDSDDNG
Sbjct:    1 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGLLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADDDGAAGEFLSCVDADVSTDDDGVISADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQLPGGNDSGDSDDNGDDSDDNG 255          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|913306815|ref|XP_013183860.1| (PREDICTED: chymotrypsin BII-like [Amyelois transitella])

HSP 1 Score: 227.639 bits (579), Expect = 4.635e-71
Identity = 128/241 (53.11%), Postives = 159/241 (65.98%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVI---SADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQLPGG 239
            MK FAL+LL  VAA QARSTG +  + A   G  P LVHLRLAV+ SG  L +C GS++D RW+LTSASCV    F+W RYGAVDV  PELV E  +   + V+ HP Y+  TGAN+IALI +NR V    +++I    LA+  AE+PSSG  C YG + +   GE L CV  +V SDD+G I   SAD + + FD+G+PL+ DGVQYGIL     S +F+NPA YRDWIE TA I LP G
Sbjct:    1 MKAFALILLFIVAAVQARSTGFKNAQLAPLSGSAPSLVHLRLAVSTSG-LLRTCAGSIIDSRWLLTSASCVAPARFIWSRYGAVDVIRPELVLETSSVDVN-VRIHPNYNAATGANNIALISLNRNV--EFTSSIVAPVLASEGAEIPSSGSFCAYGQNENNGPGEQLRCVSVEVQSDDNGAIVASSADGQPSDFDVGAPLIVDGVQYGILVDPA-SGTFLNPAGYRDWIESTAGITLPTG 236          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|953224074|gb|ALO61087.1| (serine protease [Spodoptera frugiperda])

HSP 1 Score: 206.068 bits (523), Expect = 7.352e-63
Identity = 115/235 (48.94%), Postives = 145/235 (61.70%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQL 236
            MKGFA VLLC + A Q R TGVE     A+LGENPWLVHLR+AV+ S G L++C GSL+   WVLT+ASCV    F+WIRYG VDV  P  VTE   A       HP+YD  +G N++ALI INR +    + NIA + L+ + +E   SG  C +GA +DG  GE L+C +A +S DD   +S D E+T FDLG+P+V +G Q G+LT  G   SF     Y DWIE    I  
Sbjct:    1 MKGFAFVLLCVLVAVQGRHTGVEKSGSPAALGENPWLVHLRIAVSTS-GLLDTCAGSLIGSGWVLTAASCVADQRFIWIRYGVVDVIRPSFVTEASQAV-----LHPEYDAASGKNNLALININRVI--ETTDNIAPISLSGSASE---SGTFCAFGA-SDGKPGEQLNCYEATISGDDGFSVSGDFEATEFDLGAPVVSEGAQVGLLT--GSDGSFTGVGDYIDWIESATGISF 221          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|145843820|gb|ABP96917.1| (serine protease 4, partial [Helicoverpa armigera])

HSP 1 Score: 198.749 bits (504), Expect = 8.413e-60
Identity = 115/252 (45.63%), Postives = 154/252 (61.11%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISAD---AESTIFDLGSPLVKDGVQYGILT-RAGDS-SSFINPAAYRDWIEQTAEIQLPGGDDSGDSDEN 248
            MKGFA VLLCA+ A Q R  G E+ R+AA+LGE PW+VHLR+AV  SG +LNSC+GSL+D +WVLT+ASC++   F+W+RYGAVDV  P LVTE        ++ HPQY   TGA ++ LI INR++    + NI+ V L     +V  S   C YGA  DG  GE LSC    V   D G ++ +   AE+T +D+G+P+V +GVQ  I+T  AGD  +     A+ +DW+E    I     D    SD+ 
Sbjct:    1 MKGFAFVLLCALVAVQGRHRG-ELSRQAAALGEQPWVVHLRVAVETSG-NLNSCVGSLIDNQWVLTAASCLSGSRFIWVRYGAVDVIRPSLVTENSN-----IRIHPQYSWATGAFNVGLISINRFI--QSTDNISPVALV---GDVSDSALFCGYGAREDGQPGEQLSCSSGVVEERDGGFLAFNGEGAEATKYDIGAPIVSNGVQVAIVTGVAGDERAELWAVASLKDWLENMTGINFSPNDSESGSDKK 240          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|1073525503|gb|JAT79863.1| (hypothetical protein g.7902 [Pectinophora gossypiella])

HSP 1 Score: 197.208 bits (500), Expect = 1.764e-59
Identity = 115/234 (49.15%), Postives = 146/234 (62.39%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEI---GREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVI---SADAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIE 229
            MKGFAL+LLC   A Q RST V+     +  A+LGENPWLVHLRLAV  SG  LNSC GSL+   WVLT+ SCV +  F+W+RYGAV+V  P LVTE       +V+  P + P     D+AL+ INR V    + NIA V LA++  ++P S   C +GA  DG  GE LSC D  +S   +      S D ++T FD G+PLV DGVQ GIL  +G+S +FI PA +RDWI+
Sbjct:    1 MKGFALILLCVAVAVQGRSTAVQTVASNKAVAALGENPWLVHLRLAVATSG-FLNSCAGSLISQSWVLTTGSCVENARFIWVRYGAVNVVNPSLVTE-----TSVVRVFPDWAPGRVETDVALVSINRVV--QFNENIAPVSLASS-LDLPESTNFCGFGALEDG-PGEVLSCFDVTLSGAGEISFVAQSEDGQTTQFDNGAPLVSDGVQIGILV-SGESGTFIGPAVFRDWIQ 223          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|304443627|gb|ACR15993.2| (serine protease 38 [Mamestra configurata])

HSP 1 Score: 196.438 bits (498), Expect = 2.560e-59
Identity = 112/232 (48.28%), Postives = 146/232 (62.93%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISA---DAESTIFDLGSPLVKDGVQYGILTRAGDSSSFINPAAYRDWIEQ 230
            MK FA VLLCA+AA Q R TG++    AA+LGENPWLVHLR+AV+ S G L +C GSL+  +WVLT+ASCV    F+W+RYG V+V  P LVTE       LV+ HP Y+  +G N+IALI INR V    + NI  + +     E   +GK C +G   DG  GE L+C D +VS D+DG +S    + E T +D+G+ LV DG Q G+L    DS +FI  A Y DW++Q
Sbjct:    1 MKAFAFVLLCALAAVQGRHTGLQSTSSAAALGENPWLVHLRIAVSTS-GLLETCAGSLIGNQWVLTAASCVADSRFIWVRYGVVNVINPSLVTE-----NSLVRIHPDYNLASGENNIALININRLV--ESTENIEPIGI----GESSDAGKFCAFGG-PDG-PGEILNCYDVEVSKDEDGALSVSSDEVEVTRYDVGAALVSDGAQVGVLVD--DSGNFIATAKYADWLKQ 216          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|151199966|gb|ABR88240.1| (serine protease SP1 [Heliothis virescens])

HSP 1 Score: 196.823 bits (499), Expect = 3.422e-59
Identity = 113/240 (47.08%), Postives = 151/240 (62.92%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISAD---AESTIFDLGSPLVKDGVQYGILT-RAGDSSSFINPA-AYRDWIEQTAEIQL 236
            MKGFA VLLCA+ A Q R   V I R  A+LGENPW+VHLR+AV  SG +LNSC+GSL+D +W+LT+ASC++   F+W+RYGAVDV  P LVTE        ++ HPQY   TGA ++ LI INR V   P+ANI+ V L     E   S   C YGA  DG  GE LSC    V   + G ++ +   AE++ FD+G+P+V +GVQ  ++T  AGD S+ + P  +   WIE+ + I +
Sbjct:    1 MKGFAFVLLCALVAVQGRQ--VAISRSPAALGENPWVVHLRVAVETSG-NLNSCVGSLIDNQWILTAASCLSGSRFIWVRYGAVDVIRPSLVTENSN-----IRIHPQYSWATGAFNVGLISINRNV--EPTANISPVALV---GEASDSATFCGYGASEDGQPGEQLSCYSGSVEEREGGFLAFNGEGAEASKFDIGAPIVSNGVQVAVVTGAAGDDSAELWPVESILSWIEEMSGISV 227          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|2463082|emb|CAA72961.1| (diverged serine protease [Helicoverpa armigera])

HSP 1 Score: 193.356 bits (490), Expect = 1.157e-57
Identity = 113/240 (47.08%), Postives = 151/240 (62.92%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISAD---AESTIFDLGSPLVKDGVQYGILT-RAGD-SSSFINPAAYRDWIEQTAEIQL 236
            MKGFA VLLCA+ A Q R  G E+ R+AA+LGE PW+VHLR+AV  SG +LNSC+GSL+D +WVLT+ASC++   F+W+RYGAVDV  P LVTE        ++ HPQY   TGA ++ LI INR++ +  + NI+ V L     +V  S   C YGA  DG  GE LSC    V   D G +  +   AE+T +D+G+P+V +GVQ  I+T  AGD S+     A+ +DW+E    I  
Sbjct:    1 MKGFAFVLLCALVAVQGRHRG-ELSRQAAALGEQPWVVHLRVAVETSG-NLNSCVGSLIDNQWVLTAASCLSGSRFIWVRYGAVDVIRPSLVTENSN-----IRIHPQYSWATGAFNVGLISINRFIQS--TDNISPVPLV---GDVYDSAIFCGYGAREDGQPGEQLSCYPGVVEERDTGRLVFNGEGAEATKYDIGAPIVSNGVQVAIVTGVAGDYSAELWAVASIKDWLENMTGINF 228          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|2463090|emb|CAA72965.1| (diverged serine protease [Helicoverpa armigera])

HSP 1 Score: 193.356 bits (490), Expect = 1.248e-57
Identity = 113/240 (47.08%), Postives = 151/240 (62.92%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISAD---AESTIFDLGSPLVKDGVQYGILT-RAGD-SSSFINPAAYRDWIEQTAEIQL 236
            MKGFA VLLCA+ A Q R  G E+ R+AA+LGE PW+VHLR+AV  SG +LNSC+GSL+D +WVLT+ASC++   F+W+RYGAVDV  P LVTE        ++ HPQY   TGA ++ LI INR++ +  + NI+ V L     +V  S   C YGA  DG  GE LSC    V   D G +  +   AE+T +D+G+P+V +GVQ  I+T  AGD S+     A+ +DW+E    I  
Sbjct:    1 MKGFAFVLLCALVAVQGRHRG-ELSRQAAALGEQPWVVHLRVAVETSG-NLNSCVGSLIDNQWVLTAASCLSGSRFIWVRYGAVDVIRPSLVTENSN-----IRIHPQYSWATGAFNVGLISINRFIQS--TDNISPVPLV---GDVYDSAIFCGYGAREDGQPGEQLSCYPGVVEERDTGRLVFNGEGAEATKYDIGAPIVSNGVQVAIVTGVAGDYSAELWAVASIKDWLENMTGINF 228          
BLAST of HiSeq13148 vs. genbank:protein
Match: gi|821563319|gb|AKH49603.1| (serine protease 4, partial [Helicoverpa zea])

HSP 1 Score: 189.504 bits (480), Expect = 3.832e-56
Identity = 108/240 (45.00%), Postives = 147/240 (61.25%), Query Frame = 0
Query:    2 MKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGGHLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAAGHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPSSGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISAD---AESTIFDLGSPLVKDGVQYGILTRAG--DSSSFINPAAYRDWIEQTAEIQL 236
            MKGFA VLLCA+ A Q R  G E+ R+AA+LGE PW+VHLR+AV  SG +LNSC+GSL+D +WVLT+ASC++   F+W+RYGAVDV  P LVTE        ++ HPQY   TGA ++ LI +NR++    + NI+ V       +V  S   C YGA  DG  GE LS     V   D G ++ +   AE+T +D+G+P+V +GVQ  I+T     DS+     A+ +DW+E    I  
Sbjct:    1 MKGFAFVLLCALVAVQGRHRG-ELSRQAAALGEQPWVVHLRVAVETSG-NLNSCVGSLIDNQWVLTAASCLSGSRFIWVRYGAVDVIRPSLVTENSN-----IRIHPQYSWATGAFNVGLISLNRFI--HSTDNISPVAFV---GDVSDSAIFCGYGAREDGQPGEQLSRSSGVVEERDGGFLAFNGEGAEATKYDIGAPIVSNGVQVAIVTGVAGDDSAELWAVASIKDWLENMTGINF 228          
The following BLAST results are available for this feature:
BLAST of HiSeq13148 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|209395384|gb|ACI45418.1|4.931e-17998.04serine proteinase diverged [Ostrinia nubilalis][more]
gi|913306815|ref|XP_013183860.1|4.635e-7153.11PREDICTED: chymotrypsin BII-like [Amyelois transit... [more]
gi|953224074|gb|ALO61087.1|7.352e-6348.94serine protease [Spodoptera frugiperda][more]
gi|145843820|gb|ABP96917.1|8.413e-6045.63serine protease 4, partial [Helicoverpa armigera][more]
gi|1073525503|gb|JAT79863.1|1.764e-5949.15hypothetical protein g.7902 [Pectinophora gossypie... [more]
gi|304443627|gb|ACR15993.2|2.560e-5948.28serine protease 38 [Mamestra configurata][more]
gi|151199966|gb|ABR88240.1|3.422e-5947.08serine protease SP1 [Heliothis virescens][more]
gi|2463082|emb|CAA72961.1|1.157e-5747.08diverged serine protease [Helicoverpa armigera][more]
gi|2463090|emb|CAA72965.1|1.248e-5747.08diverged serine protease [Helicoverpa armigera][more]
gi|821563319|gb|AKH49603.1|3.832e-5645.00serine protease 4, partial [Helicoverpa zea][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin-typePRINTSPR00722CHYMOTRYPSINcoord: 114..128
score: 33.87
coord: 188..200
score: 35.28
coord: 56..71
score: 46.69
IPR001254Peptidase S1SMARTSM00020Tryp_SPccoord: 23..228
e-value: 1.6E-7
score: 28.6
IPR001254Peptidase S1PFAMPF00089Trypsincoord: 25..209
e-value: 4.9E-15
score: 55.5
IPR001254Peptidase S1PROSITEPS50240TRYPSIN_DOMcoord: 24..233
score: 13.924
NoneNo IPR availableGENE3D2.40.10.10coord: 26..63
e-value: 3.2E-9
score: 36.0
NoneNo IPR availableGENE3D2.40.10.10coord: 64..232
e-value: 1.6E-17
score: 63.4
NoneNo IPR availablePANTHERPTHR24268FAMILY NOT NAMEDcoord: 25..156
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 16..20
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..15
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..20
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 21..256
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.788
IPR009003Trypsin-like cysteine/serine peptidase domainSUPERFAMILY50494Trypsin-like serine proteasescoord: 5..232

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13148HiSeq13148Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13148_p ID=HiSeq13148_p|Name=HiSeq13148|organism=Ostrinia scapulalis|type=polypeptide|length=256bp
NMKGFALVLLCAVAASQARSTGVEIGREAASLGENPWLVHLRLAVTNSGG
HLNSCIGSLVDPRWVLTSASCVNSVNFVWIRYGAVDVFTPELVTEGGAAA
GHLVQRHPQYDPVTGANDIALIRINRYVLNPPSANIAVVELAAADAEVPS
SGKVCTYGADADGAAGEFLSCVDADVSSDDDGVISADAESTIFDLGSPLV
KDGVQYGILTRAGDSSSFINPAAYRDWIEQTAEIQLPGGDDSGDSDENGD
DSDDNG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR009003Trypsin-like_Pept_dom
IPR001254Peptidase_S1
IPR001314Peptidase_S1A