HiSeq13158_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13158
Unique NameHiSeq13158_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length123
Homology
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|909568305|ref|XP_013139597.1| (PREDICTED: probable serine/threonine-protein kinase DDB_G0288147 isoform X2 [Papilio polytes])

HSP 1 Score: 212.231 bits (539), Expect = 1.809e-65
Identity = 94/119 (78.99%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETPEFV SCKERIAPWV+K+LTPFYIKGRI+G+ALFK++AKHLIRLIYQCSKYP+EYEV SFV+DFLE+HK+IRCEADFKQFRI+N+
Sbjct:  278 DCNRAKLARVKDILKDIFGEDSDDEGVMSPLEETPEFVRSCKERIAPWVVKVLTPFYIKGRIKGKALFKSLAKHLIRLIYQCSKYPNEYEVKSFVNDFLESHKVIRCEADFKQFRINNI 396          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|930669927|gb|KPJ10790.1| (hypothetical protein RR48_07796 [Papilio machaon])

HSP 1 Score: 210.69 bits (535), Expect = 6.442e-65
Identity = 94/119 (78.99%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETP+FV SCKERIAPWV+K+LTPFYIKGRI+G+ALFKA+AKHLIRLIYQCSKYP+EYEV SFVSDF+E+HK+IRCEADFKQFRI+N+
Sbjct:  279 DCNRAKLARVKDLLKDIFGEDSDDEGVMSPLEETPDFVRSCKERIAPWVVKVLTPFYIKGRIKGKALFKALAKHLIRLIYQCSKYPNEYEVKSFVSDFIESHKLIRCEADFKQFRINNI 397          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|909568303|ref|XP_013139596.1| (PREDICTED: uncharacterized protein LOC106104185 isoform X1 [Papilio polytes])

HSP 1 Score: 211.846 bits (538), Expect = 1.239e-64
Identity = 94/119 (78.99%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETPEFV SCKERIAPWV+K+LTPFYIKGRI+G+ALFK++AKHLIRLIYQCSKYP+EYEV SFV+DFLE+HK+IRCEADFKQFRI+N+
Sbjct:  340 DCNRAKLARVKDILKDIFGEDSDDEGVMSPLEETPEFVRSCKERIAPWVVKVLTPFYIKGRIKGKALFKSLAKHLIRLIYQCSKYPNEYEVKSFVNDFLESHKVIRCEADFKQFRINNI 458          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|943963816|ref|XP_014364187.1| (PREDICTED: uncharacterized protein LOC106715416 [Papilio machaon])

HSP 1 Score: 210.69 bits (535), Expect = 2.812e-64
Identity = 94/119 (78.99%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETP+FV SCKERIAPWV+K+LTPFYIKGRI+G+ALFKA+AKHLIRLIYQCSKYP+EYEV SFVSDF+E+HK+IRCEADFKQFRI+N+
Sbjct:  341 DCNRAKLARVKDLLKDIFGEDSDDEGVMSPLEETPDFVRSCKERIAPWVVKVLTPFYIKGRIKGKALFKALAKHLIRLIYQCSKYPNEYEVKSFVSDFIESHKLIRCEADFKQFRINNI 459          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|930651882|gb|KPI94224.1| (hypothetical protein RR46_06675 [Papilio xuthus])

HSP 1 Score: 208.764 bits (530), Expect = 3.696e-64
Identity = 92/119 (77.31%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETPEFV SCKERIAPWV+++LTPFYIKGRI+G+ALFK++AKHLIRLIYQCSKYP+EYEV SFV+DFL++HK+IRCEADFKQFRI+N+
Sbjct:  278 DCNRAKLARVKDLLKDIFGEDSDDEGVMSPLEETPEFVRSCKERIAPWVVRVLTPFYIKGRIKGKALFKSLAKHLIRLIYQCSKYPNEYEVKSFVNDFLDSHKLIRCEADFKQFRINNI 396          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|827558438|ref|XP_012550357.1| (PREDICTED: uncharacterized protein LOC101742851 isoform X2 [Bombyx mori])

HSP 1 Score: 208.764 bits (530), Expect = 1.435e-63
Identity = 94/121 (77.69%), Postives = 108/121 (89.26%), Query Frame = 0
Query:    3 IGDKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            IGD NRKKLARIKE+F +LFG DSDDE I+SPLEETPEFV+SCKERIAPWV+K+LTP Y KG I+G+ALFKA+AKHLI LIYQCS YP EYEV SFV DFL++H++IRCEADF QFRI+NL
Sbjct:  324 IGDSNRKKLARIKELFADLFGPDSDDESILSPLEETPEFVLSCKERIAPWVVKILTPVYTKGHIKGKALFKALAKHLINLIYQCSHYPEEYEVKSFVCDFLKSHRVIRCEADFHQFRIENL 444          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|910325531|ref|XP_013165890.1| (PREDICTED: uncharacterized protein LOC106116562 [Papilio xuthus])

HSP 1 Score: 208.764 bits (530), Expect = 1.726e-63
Identity = 92/119 (77.31%), Postives = 113/119 (94.96%), Query Frame = 0
Query:    5 DKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            D NR KLAR+K++  ++FG+DSDDEG+MSPLEETPEFV SCKERIAPWV+++LTPFYIKGRI+G+ALFK++AKHLIRLIYQCSKYP+EYEV SFV+DFL++HK+IRCEADFKQFRI+N+
Sbjct:  340 DCNRAKLARVKDLLKDIFGEDSDDEGVMSPLEETPEFVRSCKERIAPWVVRVLTPFYIKGRIKGKALFKSLAKHLIRLIYQCSKYPNEYEVKSFVNDFLDSHKLIRCEADFKQFRINNI 458          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|827558440|ref|XP_012550358.1| (PREDICTED: uncharacterized protein LOC101742851 isoform X3 [Bombyx mori] >gi|827558442|ref|XP_012550359.1| PREDICTED: uncharacterized protein LOC101742851 isoform X3 [Bombyx mori])

HSP 1 Score: 207.994 bits (528), Expect = 1.875e-63
Identity = 94/121 (77.69%), Postives = 108/121 (89.26%), Query Frame = 0
Query:    3 IGDKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            IGD NRKKLARIKE+F +LFG DSDDE I+SPLEETPEFV+SCKERIAPWV+K+LTP Y KG I+G+ALFKA+AKHLI LIYQCS YP EYEV SFV DFL++H++IRCEADF QFRI+NL
Sbjct:  312 IGDSNRKKLARIKELFADLFGPDSDDESILSPLEETPEFVLSCKERIAPWVVKILTPVYTKGHIKGKALFKALAKHLINLIYQCSHYPEEYEVKSFVCDFLKSHRVIRCEADFHQFRIENL 432          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|512927392|ref|XP_004931323.1| (PREDICTED: uncharacterized protein LOC101742851 isoform X1 [Bombyx mori])

HSP 1 Score: 208.379 bits (529), Expect = 2.381e-63
Identity = 94/121 (77.69%), Postives = 108/121 (89.26%), Query Frame = 0
Query:    3 IGDKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            IGD NRKKLARIKE+F +LFG DSDDE I+SPLEETPEFV+SCKERIAPWV+K+LTP Y KG I+G+ALFKA+AKHLI LIYQCS YP EYEV SFV DFL++H++IRCEADF QFRI+NL
Sbjct:  333 IGDSNRKKLARIKELFADLFGPDSDDESILSPLEETPEFVLSCKERIAPWVVKILTPVYTKGHIKGKALFKALAKHLINLIYQCSHYPEEYEVKSFVCDFLKSHRVIRCEADFHQFRIENL 453          
BLAST of HiSeq13158 vs. genbank:protein
Match: gi|357623078|gb|EHJ74376.1| (hypothetical protein KGM_03623 [Danaus plexippus])

HSP 1 Score: 197.208 bits (500), Expect = 1.158e-61
Identity = 85/121 (70.25%), Postives = 109/121 (90.08%), Query Frame = 0
Query:    3 IGDKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIAPWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVSDFLENHKMIRCEADFKQFRIDNL 123
            I D +RKKLARIK+ F ELFGD SDDE ++SPL+E+PE ++SCKERI PWV+K+LTP+Y+ GRIRG+ALFKA+AKHLI+LIYQCSK+P++YEV +F+ DFL NH+MIRCEADFKQF+I+N+
Sbjct:  106 IRDSDRKKLARIKQKFEELFGDVSDDEDMVSPLDESPELIMSCKERITPWVVKILTPYYVNGRIRGKALFKALAKHLIKLIYQCSKFPYDYEVENFIKDFLNNHRMIRCEADFKQFKIENV 226          
The following BLAST results are available for this feature:
BLAST of HiSeq13158 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909568305|ref|XP_013139597.1|1.809e-6578.99PREDICTED: probable serine/threonine-protein kinas... [more]
gi|930669927|gb|KPJ10790.1|6.442e-6578.99hypothetical protein RR48_07796 [Papilio machaon][more]
gi|909568303|ref|XP_013139596.1|1.239e-6478.99PREDICTED: uncharacterized protein LOC106104185 is... [more]
gi|943963816|ref|XP_014364187.1|2.812e-6478.99PREDICTED: uncharacterized protein LOC106715416 [P... [more]
gi|930651882|gb|KPI94224.1|3.696e-6477.31hypothetical protein RR46_06675 [Papilio xuthus][more]
gi|827558438|ref|XP_012550357.1|1.435e-6377.69PREDICTED: uncharacterized protein LOC101742851 is... [more]
gi|910325531|ref|XP_013165890.1|1.726e-6377.31PREDICTED: uncharacterized protein LOC106116562 [P... [more]
gi|827558440|ref|XP_012550358.1|1.875e-6377.69PREDICTED: uncharacterized protein LOC101742851 is... [more]
gi|512927392|ref|XP_004931323.1|2.381e-6377.69PREDICTED: uncharacterized protein LOC101742851 is... [more]
gi|357623078|gb|EHJ74376.1|1.158e-6170.25hypothetical protein KGM_03623 [Danaus plexippus][more]

Pages

back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13158HiSeq13158Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13158_p ID=HiSeq13158_p|Name=HiSeq13158|organism=Ostrinia scapulalis|type=polypeptide|length=123bp
MXIGDKNRKKLARIKEMFTELFGDDSDDEGIMSPLEETPEFVISCKERIA
PWVIKLLTPFYIKGRIRGRALFKAVAKHLIRLIYQCSKYPHEYEVHSFVS
DFLENHKMIRCEADFKQFRIDNL
back to top