HiSeq13160_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13160
Unique NameHiSeq13160_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length96
Homology
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|913309828|ref|XP_013185519.1| (PREDICTED: uncharacterized protein LOC106131076 [Amyelois transitella])

HSP 1 Score: 192.971 bits (489), Expect = 1.277e-56
Identity = 87/96 (90.62%), Postives = 93/96 (96.88%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRIVALTPVDCML+PKIWLLQ+NTANIWTRIQHYLEKKIPTKKQLFK+FV+ RRWQ+FR QMV DV+SRSNTVNWTSVHDVPYSIRMEEMLDI
Sbjct:  506 MRDRRIVALTPVDCMLMPKIWLLQKNTANIWTRIQHYLEKKIPTKKQLFKEFVSQRRWQDFRNQMVDDVVSRSNTVNWTSVHDVPYSIRMEEMLDI 601          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|357619603|gb|EHJ72108.1| (hypothetical protein KGM_05068 [Danaus plexippus])

HSP 1 Score: 187.963 bits (476), Expect = 1.715e-56
Identity = 86/96 (89.58%), Postives = 92/96 (95.83%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRIVALTPV+CMLLP IWLLQRNTANIW+RIQHYLEKKIP KKQLFK+FVA RRWQEFREQ+V DV++RSNTVNWTSVHDVPYSIRMEEMLDI
Sbjct:  299 MRDRRIVALTPVNCMLLPMIWLLQRNTANIWSRIQHYLEKKIPNKKQLFKEFVAARRWQEFREQLVEDVVARSNTVNWTSVHDVPYSIRMEEMLDI 394          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|512913179|ref|XP_004927834.1| (PREDICTED: uncharacterized protein LOC101737495 [Bombyx mori])

HSP 1 Score: 190.66 bits (483), Expect = 2.952e-56
Identity = 88/96 (91.67%), Postives = 91/96 (94.79%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYL+KKIPTKK LFK FV  RRWQEFR+QMV DV+SRSNTVNWTSVHDVPYSIRMEEMLDI
Sbjct:  448 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLDKKIPTKKDLFKQFVEDRRWQEFRDQMVDDVVSRSNTVNWTSVHDVPYSIRMEEMLDI 543          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|910343412|ref|XP_013175472.1| (PREDICTED: uncharacterized protein LOC106123603 [Papilio xuthus])

HSP 1 Score: 184.111 bits (466), Expect = 1.016e-53
Identity = 82/96 (85.42%), Postives = 91/96 (94.79%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RIQHYLEKKIPTKKQLFK+FV+ RRW+EFREQ V DV+SR+NTVNWT+VHDVPYSIR+EEM DI
Sbjct:  455 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIQHYLEKKIPTKKQLFKEFVSARRWEEFREQTVADVVSRTNTVNWTTVHDVPYSIRIEEMKDI 550          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|930659895|gb|KPJ01937.1| (Uncharacterized protein C20orf152-like [Papilio xuthus])

HSP 1 Score: 184.111 bits (466), Expect = 1.082e-53
Identity = 82/96 (85.42%), Postives = 91/96 (94.79%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RIQHYLEKKIPTKKQLFK+FV+ RRW+EFREQ V DV+SR+NTVNWT+VHDVPYSIR+EEM DI
Sbjct:  455 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIQHYLEKKIPTKKQLFKEFVSARRWEEFREQTVADVVSRTNTVNWTTVHDVPYSIRIEEMKDI 550          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|930677067|gb|KPJ17202.1| (Uncharacterized protein C20orf152-like [Papilio machaon])

HSP 1 Score: 181.8 bits (460), Expect = 9.774e-53
Identity = 81/96 (84.38%), Postives = 90/96 (93.75%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RIQHYLEKKIPTKKQLFK+FV+ RRW+EFREQ V DV+SR+ TVNWT+VHDVPYSIR+EEM DI
Sbjct:  453 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIQHYLEKKIPTKKQLFKEFVSARRWEEFREQTVADVVSRTKTVNWTTVHDVPYSIRIEEMKDI 548          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|943944412|ref|XP_014355558.1| (PREDICTED: uncharacterized protein LOC106708537 [Papilio machaon])

HSP 1 Score: 181.415 bits (459), Expect = 1.077e-52
Identity = 81/96 (84.38%), Postives = 90/96 (93.75%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RIQHYLEKKIPTKKQLFK+FV+ RRW+EFREQ V DV+SR+ TVNWT+VHDVPYSIR+EEM DI
Sbjct:  455 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIQHYLEKKIPTKKQLFKEFVSARRWEEFREQTVADVVSRTKTVNWTTVHDVPYSIRIEEMKDI 550          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|909560506|ref|XP_013135344.1| (PREDICTED: uncharacterized protein LOC106100833 isoform X1 [Papilio polytes])

HSP 1 Score: 180.259 bits (456), Expect = 3.036e-52
Identity = 81/96 (84.38%), Postives = 91/96 (94.79%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RIQH+LEKKIPTKKQLFK+FV+ RRW+EFREQ V DVISR++TVNWT+VHDVPYSIR+EEM DI
Sbjct:  454 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIQHFLEKKIPTKKQLFKEFVSARRWEEFREQTVADVISRTHTVNWTTVHDVPYSIRIEEMKDI 549          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|910343410|ref|XP_013175471.1| (PREDICTED: uncharacterized protein LOC106123602 isoform X2 [Papilio xuthus])

HSP 1 Score: 177.948 bits (450), Expect = 4.792e-52
Identity = 76/96 (79.17%), Postives = 92/96 (95.83%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQRNTANIW+RI+HYL+KKIP+KKQLFK+FV+ RRW+E+R Q+V+D++SR+NTVNWT+VHDVPYSIR+EEM DI
Sbjct:  361 MRDRRIIALTPVDCMLLPSIWLLQRNTANIWSRIKHYLDKKIPSKKQLFKEFVSTRRWEEYRGQIVSDIVSRTNTVNWTTVHDVPYSIRIEEMTDI 456          
BLAST of HiSeq13160 vs. genbank:protein
Match: gi|943944388|ref|XP_014355549.1| (PREDICTED: uncharacterized protein LOC106708529 [Papilio machaon])

HSP 1 Score: 178.333 bits (451), Expect = 1.951e-51
Identity = 77/96 (80.21%), Postives = 93/96 (96.88%), Query Frame = 0
Query:    1 MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFKDFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI 96
            MRDRRI+ALTPVDCMLLP IWLLQ+NTANIW+RI+HYL+KKIP+KKQLFK+FV+ RRW+E+REQ+V+DVISR+NTVNWT+VHDVPYSIR+EEM +I
Sbjct:  461 MRDRRIIALTPVDCMLLPSIWLLQKNTANIWSRIKHYLDKKIPSKKQLFKEFVSTRRWEEYREQIVSDVISRTNTVNWTTVHDVPYSIRIEEMTNI 556          
The following BLAST results are available for this feature:
BLAST of HiSeq13160 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913309828|ref|XP_013185519.1|1.277e-5690.63PREDICTED: uncharacterized protein LOC106131076 [A... [more]
gi|357619603|gb|EHJ72108.1|1.715e-5689.58hypothetical protein KGM_05068 [Danaus plexippus][more]
gi|512913179|ref|XP_004927834.1|2.952e-5691.67PREDICTED: uncharacterized protein LOC101737495 [B... [more]
gi|910343412|ref|XP_013175472.1|1.016e-5385.42PREDICTED: uncharacterized protein LOC106123603 [P... [more]
gi|930659895|gb|KPJ01937.1|1.082e-5385.42Uncharacterized protein C20orf152-like [Papilio xu... [more]
gi|930677067|gb|KPJ17202.1|9.774e-5384.38Uncharacterized protein C20orf152-like [Papilio ma... [more]
gi|943944412|ref|XP_014355558.1|1.077e-5284.38PREDICTED: uncharacterized protein LOC106708537 [P... [more]
gi|909560506|ref|XP_013135344.1|3.036e-5284.38PREDICTED: uncharacterized protein LOC106100833 is... [more]
gi|910343410|ref|XP_013175471.1|4.792e-5279.17PREDICTED: uncharacterized protein LOC106123602 is... [more]
gi|943944388|ref|XP_014355549.1|1.951e-5180.21PREDICTED: uncharacterized protein LOC106708529 [P... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR23011:SF2SUBFAMILY NOT NAMEDcoord: 2..92
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 2..92

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13160HiSeq13160Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13160_p ID=HiSeq13160_p|Name=HiSeq13160|organism=Ostrinia scapulalis|type=polypeptide|length=96bp
MRDRRIVALTPVDCMLLPKIWLLQRNTANIWTRIQHYLEKKIPTKKQLFK
DFVAHRRWQEFREQMVTDVISRSNTVNWTSVHDVPYSIRMEEMLDI
back to top