HiSeq13204_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13204
Unique NameHiSeq13204_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length864
Homology
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|112983936|ref|NP_001036846.1| (nonclathrin coat protein gamma1-COP [Bombyx mori] >gi|8100038|dbj|BAA93047.2| nonclathrin coat protein gamma1-COP [Bombyx mori])

HSP 1 Score: 1414.82 bits (3661), Expect = 0.000e+0
Identity = 689/863 (79.84%), Postives = 777/863 (90.03%), Query Frame = 0
Query:    2 SRRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            +RRD KE++     +FQNLDKTTL+QEARYFNSTPV+PRKCIHILTKI+YLL QGE+L TQEATD+FFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGK+D YR AAIRALC ITDSTMLQAIERYMKQAIVDKNPAV SAALVSALHLSATVPDLVRRW+NEAQEA+ S++ MVSYHALAVVAGARRNDRLSTVKL+TK +RTP+RSPY L L IR+AAKL+EED ++A++ YL+FIESCLR+KSE+VVYEAAHAIVN  KS K +A AVSVLQIFCGSSK  LR AGARTLA+LTAKHPNAVA CA DLENLISD NRSVATLAVTTLLATG ESSIDRLMKQIS FMSEISDEFKIVVV+AIRRLCSKYPRKHQSLAAFLAGMLRDEGG+QYKTAIA+A+IAL+EENP+AKETGLAHLCEFIEDCEH +LAVRILHVLGREGPKARQPSRYIRYIYNRVILESG VRAAAVS VARFGA+RPELLPNIRVLL+RC LD+DDEVRDRA++YSAILDSG+PQLINDYIIN+ +PNPVLLEK+L D++ SG  + E FNIAAVP+AEEP+E KE+P+EIE+RK PVVSREE+Y E+L+ +PGIEK+GP+FK+CE+IDLTEPETEYRVRCVKHI++RH+ILQFECLNTLSDQLL +V+VRL   PGY++ + VPCD LPY+KQ +IF LL FPENP+++  +F A+LEFVVRDCDPTTGLPD   GY DTYPLEE EI CADQFR RAA DDWE +W  AA+A EA DTFGL+QSDVG AA AVCEHLG+PKA+I G+AVK+IRGGG+WR G P+L+RARLV+AQG VTMQL  RS +  +AT LLAAVG
Sbjct:    3 ARRDGKEED---SNVFQNLDKTTLLQEARYFNSTPVHPRKCIHILTKILYLLNQGEELTTQEATDIFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKDDEYRPAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVGSAALVSALHLSATVPDLVRRWINEAQEAMTSDHVMVSYHALAVVAGARRNDRLSTVKLITKLARTPVRSPYTLCLQIRFAAKLAEEDPSEASEPYLEFIESCLRNKSEMVVYEAAHAIVNLRKSAKDLAQAVSVLQIFCGSSKATLRLAGARTLARLTAKHPNAVAACAVDLENLISDSNRSVATLAVTTLLATGAESSIDRLMKQISEFMSEISDEFKIVVVRAIRRLCSKYPRKHQSLAAFLAGMLRDEGGLQYKTAIAEALIALIEENPDAKETGLAHLCEFIEDCEHVTLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGPVRAAAVSAVARFGASRPELLPNIRVLLSRCQLDEDDEVRDRAVFYSAILDSGNPQLINDYIINIQVPNPVLLEKSLSDYLASGD-QSEPFNIAAVPTAEEPQEPKESPVEIETRKAPVVSREEQYTEQLQAIPGIEKLGPLFKSCEAIDLTEPETEYRVRCVKHIFARHLILQFECLNTLSDQLLEKVYVRLDSIPGYKISNVVPCDELPYDKQGNIFCLLEFPENPIETLGNFGATLEFVVRDCDPTTGLPDSNEGYADTYPLEEIEITCADQFRTRAATDDWEQAWERAANAAEACDTFGLTQSDVGAAASAVCEHLGMPKAAISGEAVKEIRGGGLWRAGAPVLMRARLVAAQGTVTMQLITRSPREDVATLLLAAVG 861          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|357622650|gb|EHJ74076.1| (nonclathrin coat protein gamma1-COP [Danaus plexippus])

HSP 1 Score: 1386.32 bits (3587), Expect = 0.000e+0
Identity = 693/862 (80.39%), Postives = 770/862 (89.33%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            RRDKKE+ED  G +FQNLDKT L+QEARYFNSTPV P+KC+ ILTKI+YLL QGEKL TQEATD+FFATTKLFQSKDVVLRRLVYLCIKELS MAQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVP+LVRRWVN+AQEAIMS+NAMVSYHALAVVAGARRNDRLSTVKLVTK SR+PLRSP+AL LL+RYAAKL+EED+T+A++ YL+FIE CLRHKSEIVVYEAAHAIVN  KS + +A AVSVLQIFCGSSK  LR AGARTLAKLT KHPNAVA CA DLENLISDPNRSVATLAVTTLLATG ESSIDRLMKQIS FMSEISDEFKIVVV+AIRRLC+KYPRKHQSLA+FLAGMLRDEGGVQYKTAIADAIIAL+EENP+AKETGLAHLCEFIEDCEHTSLAVRIL+VLGREGPKARQPSRYIRYIYNRVILESG VRAAAVS VARFGAT  +LLPNI VLLARC LDDDDEVRDRAI+++AIL+S DPQLI+DYI NVP PNPVLLEKAL D +      ++ FNI +VPS+E  KE +E P++IE+RKQPVVS EE Y+E+LKVVPGIEK+GP FKTC++IDLTEPETEYRVRCVKHI++RH+ILQFECLNTLSDQLL +V VRL   PGY++L EVPC+ LPY+KQ S+F LL FP  P+++  +F A+LEF VRDCDPTTGLPDGG GY+DTYPLEE +I CA+QFR   A DDWE+SW   ASA EASDTF LSQSD+ EAA AVC HLGLPKA+I GDAVK+IRGGG+WR G P+L+RARLV++QG+VTM+LT RS +  +AT LLAAVG
Sbjct:    5 RRDKKEEEDTGGNVFQNLDKTALLQEARYFNSTPVIPKKCVQILTKILYLLNQGEKLTTQEATDIFFATTKLFQSKDVVLRRLVYLCIKELSSMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPELVRRWVNDAQEAIMSDNAMVSYHALAVVAGARRNDRLSTVKLVTKLSRSPLRSPFALCLLVRYAAKLAEEDQTEASEPYLEFIECCLRHKSEIVVYEAAHAIVNLRKSARDLAQAVSVLQIFCGSSKATLRLAGARTLAKLTTKHPNAVAACAVDLENLISDPNRSVATLAVTTLLATGAESSIDRLMKQISTFMSEISDEFKIVVVRAIRRLCTKYPRKHQSLASFLAGMLRDEGGVQYKTAIADAIIALIEENPDAKETGLAHLCEFIEDCEHTSLAVRILYVLGREGPKARQPSRYIRYIYNRVILESGPVRAAAVSAVARFGATCEDLLPNISVLLARCQLDDDDEVRDRAIFFNAILNSNDPQLISDYITNVPTPNPVLLEKALHDHLKMNP--DKPFNILSVPSSEPTKEPEEAPVQIETRKQPVVSLEELYSEQLKVVPGIEKLGPPFKTCKAIDLTEPETEYRVRCVKHIFARHLILQFECLNTLSDQLLEKVRVRLETAPGYKILCEVPCEQLPYDKQGSVFCLLEFPHGPIETLGTFGATLEFSVRDCDPTTGLPDGGDGYSDTYPLEELDIGCAEQFRAHVATDDWEASWERTASAAEASDTFVLSQSDINEAASAVCTHLGLPKAAISGDAVKEIRGGGLWREGTPMLVRARLVASQGSVTMKLTARSPREDVATLLLAAVG 864          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|1073533533|gb|JAT83878.1| (hypothetical protein g.7051 [Pectinophora gossypiella])

HSP 1 Score: 1372.45 bits (3551), Expect = 0.000e+0
Identity = 672/862 (77.96%), Postives = 773/862 (89.68%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            RRDKK ++D    +FQNLDKTTL+QE+RYFNSTPVNPRKCIHILTKI+YLL QGEKL TQEATD+FFATTKLFQSKDVVLRRL+YLCIKELS MAQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRW NEAQEA+MS++ MVSYHALAVVA AR+NDRLSTVKLVTK +RTPLRSPYAL LLIRYAAKL+EED++D+++ Y++FIESCLRHKSEIVVYEAAHAI++  K+ + +A AVSVLQIFCGSSK  LR AGARTLAKLTAKHP+AVA C  DLENLISDPNRSVATLAVTTLLATG ESSIDRLMK ++ FMSEISDEFK++VV+AIRRLCSKYPRK+Q+LA+FLAGMLRDEGG+QYKTAIADAIIAL+EENP+AKETGLAHLCEFIEDCEHTSLAVRILHVLGREGP+ARQPSRYIRYIYNRVILESG VRAAAV+ VARFGA RPELLPNIRVLL+RC LD+DDEVRDRA  YSAILDSG+P+++ +YI+NV +PN VLLE+AL D + +    +E FNI+AVP+ EEP+E KE P E E  ++PV+S EE+YA++LKV+PGIEK+GP FKTCE++DLTEPETEYRVRCVKHI++RH+ILQFECLNTLSDQ+L R+HVRL  P GY++L EVPCD L Y+KQ S+F +L FPENP+++  +F A+LEF VRDCDPTTGLPD G GY DTYP+E+ EI C++QFR+R A +DW++SW  AA+A EA DTFGL+Q+DVGEAA AVCEHLGLPK++I GDAVKDIRGGG+WRGG P+L+RARLV+AQG VTMQL+ RS +  +AT LLAAVG
Sbjct:    5 RRDKKGEDDGGVNVFQNLDKTTLLQESRYFNSTPVNPRKCIHILTKILYLLNQGEKLTTQEATDIFFATTKLFQSKDVVLRRLMYLCIKELSGMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWANEAQEAVMSDHVMVSYHALAVVASARKNDRLSTVKLVTKLARTPLRSPYALCLLIRYAAKLAEEDQSDSSEQYIEFIESCLRHKSEIVVYEAAHAIISLRKTVRDLAQAVSVLQIFCGSSKATLRLAGARTLAKLTAKHPSAVAACTVDLENLISDPNRSVATLAVTTLLATGAESSIDRLMKPMASFMSEISDEFKVIVVRAIRRLCSKYPRKYQTLASFLAGMLRDEGGLQYKTAIADAIIALIEENPDAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPRARQPSRYIRYIYNRVILESGPVRAAAVTAVARFGAARPELLPNIRVLLSRCQLDEDDEVRDRATIYSAILDSGNPEILEEYILNVQVPNVVLLERALHDHLETFP--DEPFNISAVPTEEEPQEAKEAPAETEITRKPVISLEEQYADQLKVIPGIEKLGPPFKTCEAVDLTEPETEYRVRCVKHIFARHLILQFECLNTLSDQMLGRIHVRLDPPAGYKMLGEVPCDQLVYDKQGSVFSILEFPENPIETLGAFGATLEFTVRDCDPTTGLPDSGEGYGDTYPIEDVEIACSEQFRMRPASEDWDASWERAANAAEACDTFGLAQTDVGEAAKAVCEHLGLPKSAIAGDAVKDIRGGGLWRGGVPVLVRARLVAAQGIVTMQLSARSPREDVATLLLAAVG 864          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|913308807|ref|XP_013184959.1| (PREDICTED: coatomer subunit gamma-like [Amyelois transitella])

HSP 1 Score: 1351.27 bits (3496), Expect = 0.000e+0
Identity = 675/848 (79.60%), Postives = 748/848 (88.21%), Query Frame = 0
Query:   17 FQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
             QNLDKTTLIQEARYFNSTPVNPRKC+HILTKIIYL+ QGE L TQEATD+FFATTKLFQSKDVVLRRLVYLCIKELS +AQDVIIVTSSLTKDMTG+EDLYRAAAIRALC ITDS+MLQAIERYMKQAIVDKNPA+SSAALVSALHLSATVPDLV+RWVNEAQEAI SE  MVSYHALAVVAGARRNDRLSTVKLVTK +R PLRSPY L+ LIR AAK+ +ED  DA+D  LDF+ESCLRHKSEIVVYEAAHA++N  K TK++AHAVSVLQIFCGSSK  LR AGARTLAKL  KHPN VA+CA DLENLISD NRSVATLAVTTLLATG ESSIDRLMKQISGFMSEI DEFKIVVV AIR LCSKYPRKH SL+ FLAGMLRDEGG++YKTAIADA+IAL+EENP+AKETGLAHLCEFIEDCEHT LAVRIL+VLGREGPKARQPSRYIRYIYNRVILE+G VRAAAV+ VARFGA RPELLPNIRVLL+RC LDDDDEVRDRA++YSAILDSGD QLINDYI+N+P+PN VLLE+AL D++ S  A  E FNI  VP  EE ++ KETP+EIE+RK P+VS EEKYA+ELKVVPGIE  GPIFKTCE++DLTEPETEYRV CVKH+++RHVILQFECLNTLSDQLL +VHVRL   PGY + SEVPC  LPYNKQ S+F +L FPENP+++  SF A+LEFVVRDCD TTGLPD G GY DTYPLEE E+ CA+QFR R A DDWE++W  AASA EASDTF L+Q+D G AA+AVC+HLGL +A++ GDAVKDI+GGG+WR G PIL+RARL +AQGAVTMQL VRST+  +AT LL AVG
Sbjct:   15 LQNLDKTTLIQEARYFNSTPVNPRKCVHILTKIIYLINQGEDLTTQEATDLFFATTKLFQSKDVVLRRLVYLCIKELSSLAQDVIIVTSSLTKDMTGQEDLYRAAAIRALCSITDSSMLQAIERYMKQAIVDKNPAISSAALVSALHLSATVPDLVKRWVNEAQEAITSEQVMVSYHALAVVAGARRNDRLSTVKLVTKLTRAPLRSPYTLSYLIRLAAKIVDED-PDASDP-LDFLESCLRHKSEIVVYEAAHALLNLKKQTKSLAHAVSVLQIFCGSSKATLRLAGARTLAKLAIKHPNLVANCAADLENLISDSNRSVATLAVTTLLATGAESSIDRLMKQISGFMSEIPDEFKIVVVNAIRCLCSKYPRKHHSLSTFLAGMLRDEGGLEYKTAIADALIALIEENPDAKETGLAHLCEFIEDCEHTFLAVRILNVLGREGPKARQPSRYIRYIYNRVILENGPVRAAAVAAVARFGAARPELLPNIRVLLSRCHLDDDDEVRDRAVFYSAILDSGDQQLINDYILNIPMPNTVLLERALNDYLASEDAGNEPFNIDLVPVEEEVEKAKETPVEIETRKAPIVSLEEKYADELKVVPGIENFGPIFKTCEAVDLTEPETEYRVCCVKHVFARHVILQFECLNTLSDQLLAKVHVRLDAIPGYVMHSEVPCGQLPYNKQGSVFCVLEFPENPIETLGSFGATLEFVVRDCDATTGLPDEGEGYADTYPLEEIEMGCAEQFRFRPATDDWEAAWERAASAPEASDTFALAQTDAGVAALAVCQHLGLSQAAVSGDAVKDIKGGGIWREGAPILIRARLAAAQGAVTMQLLVRSTRQDVATLLLTAVG 860          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|768415665|ref|XP_011548390.1| (PREDICTED: coatomer subunit gamma-like [Plutella xylostella])

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 672/863 (77.87%), Postives = 749/863 (86.79%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEK-LGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            RRDKKE+E+  G  FQNLDKTTL+QEARYFN TPVN RKC  ILTKI+YLL  G++ L TQEAT++FFATTKLFQSKDVVLRRLVYL IKELS  AQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRW NEAQEAIMS+N MVSYHAL VV G+RRNDRLSTVKL+TK +++ LR+PY + LLIR+AAKL+EED  DA+D Y+DFIESCLRHKSEIVVYEAAHAIVN  KS + +A AVSVLQIFCGSSK  LR AGARTLAKLTAKHPNAVA CA DLENLISDPNRSVATLAVTTLLATG ESSIDRLMKQIS FMSEISDEFKIVVV+AI+RLC+KYPRKHQSLAAFLAGMLRDEGG++YKTAIADAIIALVEENP+AKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIR+IYNRVILESG VRAAAVS VARFGA RPEL+PNI VLLARCT+DDDDEVRDRAIYYSAIL+SGD  L+++YI+NVP PNPVLLEKAL D +         F+I  +P   E  E KETP EIE RK   VSREE+YA++L V+PGIEKIGP FKTCE++DLTE ETEYR+RCVKH+++RH++LQFECLNTLSDQLL +VHVRL  P GY+LL EV C+ LPY+KQ S+F LL FP+NP+++  SF A+LEF VRDCDPTTG P+ G GY D+YPLEE  I CA+Q R +A  DDWE++W  AASA EA DTFGLSQ+DVGEAA  VCE+LG PK+SI GDAVK+IRGGGMWRGG P+L+RA+L +A GAVTMQLT RS +  IAT LLAA+G
Sbjct:    5 RRDKKEEEEGGGNPFQNLDKTTLLQEARYFNETPVNHRKCTLILTKILYLLNHGDQELTTQEATEIFFATTKLFQSKDVVLRRLVYLLIKELSSQAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWANEAQEAIMSDNMMVSYHALGVVVGSRRNDRLSTVKLITKLAKSSLRTPYGVCLLIRHAAKLAEEDGNDASDVYIDFIESCLRHKSEIVVYEAAHAIVNLRKSARDLAQAVSVLQIFCGSSKATLRLAGARTLAKLTAKHPNAVAACAVDLENLISDPNRSVATLAVTTLLATGAESSIDRLMKQISTFMSEISDEFKIVVVRAIKRLCTKYPRKHQSLAAFLAGMLRDEGGLEYKTAIADAIIALVEENPDAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRFIYNRVILESGPVRAAAVSAVARFGAARPELMPNISVLLARCTVDDDDEVRDRAIYYSAILESGDKDLVDEYILNVPKPNPVLLEKALRDHI--ANTPNSPFDIDTIPVLAEAVEVKETPAEIEQRKPAAVSREEQYADQLNVIPGIEKIGPPFKTCETVDLTEAETEYRIRCVKHVFARHLVLQFECLNTLSDQLLEKVHVRLEPPAGYQLLGEVACNELPYDKQGSVFLLLQFPDNPMETLGSFGATLEFNVRDCDPTTGEPEPGEGYADSYPLEEVTIGCAEQMRAKAMTDDWEATWERAASAAEACDTFGLSQNDVGEAAATVCEYLGWPKSSISGDAVKEIRGGGMWRGGVPVLVRAKLAAAGGAVTMQLTARSPREDIATVLLAAIG 865          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|768441171|ref|XP_011562295.1| (PREDICTED: LOW QUALITY PROTEIN: coatomer subunit gamma-2-like [Plutella xylostella])

HSP 1 Score: 1243.41 bits (3216), Expect = 0.000e+0
Identity = 609/862 (70.65%), Postives = 712/862 (82.60%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            + DKKEDED  G  F NLDKT ++QE R F+ TP N RKC HIL KI+Y+L QGE L TQEATD FFA TKLFQSKD+VLRR+VYLCIKELS MAQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSAT PDLVRRW  EAQEAI S+NAMVSYHAL VV   R+ND+L++ KLV++ +R PL+SPYAL LLIR AA+L + DE+DA+  Y++FIE CLRHKSE+V+YEAAHAIVN  K+ + +A AVSVLQ+FCGSSKP LR AGARTLA+LT KHP AVA C    EN ISD N S A  AVT  LATG ESS+DRLMKQIS F+SEISDEFKIVVV+AIRRLC+K+PRKHQ+L AFLAGMLRDEGG++YK AIADAII+LVEENPEAKE+GLAHLCEFIEDCEHT+LAVRILH+LGREGPK+RQPSRYIR+IYNRVILESG VRAAAVS +A+FGA RPELLPNIRV+LARC LD+DDEVRDRA+ YSAILDS D  LI+DYIINVP PNPVLLEKAL D + +    +E F++ +VP+ EEPK  KE  IEIE+RK  ++SREE+YA+++ ++PGI K GP+FKT ++++LTE  TEYR+RCVKHI++RH+ILQFECLNTLSD LL RV VRL  PP Y+++SE+PCD LPY+K  ++F +L FP   LDS  +F ASLEF VRDCDPTTG+P+ G GY D YPLEE +I C DQ R RA  DDW+++W  ++SA E  DTF LSQ+D  EAA AVCEHLGLPK +I G+AVK+IRG G++R G P+L+RARL  + G VTMQL  RS +  +A  LLAAVG
Sbjct:    4 KMDKKEDEDGGGNPFSNLDKTNVLQETRCFSETPTNHRKCTHILAKILYILNQGETLTTQEATDAFFAITKLFQSKDMVLRRMVYLCIKELSSMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCTITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATAPDLVRRWAGEAQEAINSDNAMVSYHALGVVYSTRKNDKLASAKLVSRLTRAPLKSPYALCLLIRQAAQLVDNDESDASQPYIEFIECCLRHKSEMVIYEAAHAIVNLRKTARDLAPAVSVLQLFCGSSKPSLRLAGARTLARLTTKHPTAVAACXVVAENXISDSNGSGAVWAVTPFLATGAESSVDRLMKQISSFVSEISDEFKIVVVKAIRRLCTKFPRKHQALTAFLAGMLRDEGGLEYKAAIADAIISLVEENPEAKESGLAHLCEFIEDCEHTALAVRILHLLGREGPKSRQPSRYIRFIYNRVILESGPVRAAAVSALAQFGAQRPELLPNIRVVLARCQLDEDDEVRDRAVLYSAILDSEDRGLIDDYIINVPKPNPVLLEKALRDHLETNP--DEPFDVMSVPTTEEPKPEKEV-IEIEARKPVLLSREEQYADQIALIPGIAKFGPLFKTTDTVELTEEGTEYRIRCVKHIFARHMILQFECLNTLSDVLLERVQVRLETPPEYKIISEIPCDKLPYDKPGNVFCILEFPHATLDSLGTFGASLEFSVRDCDPTTGVPESGDGYDDNYPLEEIDIGCDDQLRTRAVTDDWDATWERSSSAIEVCDTFVLSQTDALEAAKAVCEHLGLPKTAIVGEAVKEIRGCGLFRNGAPVLVRARLAMSGGGVTMQLAARSPREDVAQLLLAAVG 862          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|1073531041|gb|JAT82632.1| (hypothetical protein g.19439, partial [Pectinophora gossypiella])

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 612/819 (74.73%), Postives = 707/819 (86.32%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGG 821
            +RDKKE+ED+ G  FQNLDKT ++QE+RYFN TPVNPRKC HILTKI+YLL QGEKL TQEATD FFATTKLFQSKDV+LRR+VYLCIKELS MAQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKN AVSSAALVSALHLS+T PDLVRRW NEAQEAI S+NAMVSYHAL VVA +R+ND+LSTVKLV++  R  L+SPYAL +LIR AA+L E+D+++A+  Y++FIE CLRHKSE+V+YEAAHAIVN  K+ + +A AVSVLQ+FCGSSK  LR AGARTLA+LTAKHP AVA CA DLENLISDPNRSVATLAVTTLLATG ESS+DRLMKQIS F+SEISDEFKIVVV+AIRRLC+K+PRKHQSLAAFLAGMLRDEGG++YK AIADAIIALVEENP+AKETGLAHLCEFIEDCEHT+LAVRILH+LGREGPK+RQPSRYIR+IYNRVILESG VRAAAVS VA+FGA RPELLPNIRVLLARC LDD+DEVRDRAIYYSAILD+GD QLIND+I+N+P PNPVLLEKAL D + +    +E F+I  VP+ EE KE+KE  +EIE RK   +S EE Y+E+L  +PGIE++GP+FKT + +DLTE ETEYRVR +KH+Y RHV+LQFEC+NTLSDQLL +VHV+L  PP Y + + + C  L Y+K  S+F L+ +P   LDS  +F A+LEF V+DCDPT+GLPD G GY D+YPLEEFE+ CADQ R RAA DDWE +W  A++A EASDTF LSQ+D+ +AA AVCEHLGLPK +I G+AVK+IRGGG
Sbjct:    5 KRDKKEEEDSGGNPFQNLDKTIVLQESRYFNETPVNPRKCTHILTKILYLLNQGEKLTTQEATDAFFATTKLFQSKDVMLRRMVYLCIKELSTMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQAIERYMKQAIVDKNSAVSSAALVSALHLSSTAPDLVRRWANEAQEAISSDNAMVSYHALGVVACSRKNDKLSTVKLVSRLGRANLKSPYALCMLIRLAAQLVEDDDSEASQPYIEFIECCLRHKSEMVIYEAAHAIVNLRKTARDLAPAVSVLQLFCGSSKAALRLAGARTLARLTAKHPTAVAACAVDLENLISDPNRSVATLAVTTLLATGAESSVDRLMKQISSFVSEISDEFKIVVVKAIRRLCTKFPRKHQSLAAFLAGMLRDEGGLEYKAAIADAIIALVEENPDAKETGLAHLCEFIEDCEHTALAVRILHLLGREGPKSRQPSRYIRFIYNRVILESGPVRAAAVSAVAQFGAQRPELLPNIRVLLARCQLDDEDEVRDRAIYYSAILDTGDQQLINDFIVNIPKPNPVLLEKALRDHLATNP--DEPFDIMTVPTEEEQKESKEPVVEIEVRKPVQMSLEELYSEQLAKIPGIERLGPLFKTTQPVDLTEAETEYRVRLLKHVYGRHVVLQFECVNTLSDQLLEQVHVKLEVPPEYEIKTVITCPKLQYDKPGSVFVLVEYPCAFLDSLGTFGATLEFTVKDCDPTSGLPDPGEGYADSYPLEEFEMGCADQIRARAATDDWEQTWERASNAPEASDTFVLSQNDINDAAKAVCEHLGLPKNAIVGEAVKEIRGGG 821          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|913331827|ref|XP_013197508.1| (PREDICTED: coatomer subunit gamma [Amyelois transitella])

HSP 1 Score: 1214.91 bits (3142), Expect = 0.000e+0
Identity = 631/862 (73.20%), Postives = 729/862 (84.57%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            +RDKKE+ED  G  +QNLDKT ++QEARYFN TPVNPRKC  IL++++YLL QGEKL TQEAT+ FFATTKLFQSKDV+LRR+VYLCIKELS +AQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSAT PDLVRRW NEAQEAI S NAMVSYHAL VVA  R+ND+LSTVKLV+    + ++SPY L LLIR AA+L ++DE+DAA  Y++FIE CLRHKSE+V+YEAAHAIVN  K+ + +A AVSVLQ+FCGSSK  LR AGARTLA+LTAKHP AVA CA DLENLISDPNRSVATLAVTTLLATG ESS+DRLMKQIS F++EISDEFKIVVV+AIRRLC+K+PRKHQ+LAAFLAGMLRDEGG++YK AIADAIIALVEENPEAKETGLAHLCEFIEDCEHT+LAVRILH+LGREGPK+RQPSRYIR+IYNRVILESG VRAAAVS VA+FGA RPELLPNI VLL+RC +DD+DEVRDRAIYYSAIL++GDPQLINDYI+NVP PN VLLEKAL D + +    +E F++  VP+ EEPKE KE  +EIE +K   +S EE YAE+L  + GIE++GP+FKT + +DLTE ETEYRVR +KHI+ RH+ILQFEC+NTLSDQLL  V VRL  PP Y + S  PC  L Y+K  ++F ++ FP   LDS  +F A+LEFVVRDCDPTTG PD G GY D+YPLEEFEI C+DQ R RAA DDW+ +W  A++A EASDTF LSQ+DV EAA AVCEHLGLPKA+I G+AVK+IRGGG++RGG P+L+RARL  +   VTM+L  RS +  +A  LLAAVG
Sbjct:    5 KRDKKEEEDGGGNPYQNLDKTIVLQEARYFNQTPVNPRKCCLILSRVLYLLNQGEKLTTQEATEAFFATTKLFQSKDVMLRRMVYLCIKELSTLAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATAPDLVRRWSNEAQEAI-SNNAMVSYHALGVVASTRKNDKLSTVKLVSGLIHSVIKSPYTLCLLIRLAAQLVDDDESDAAQPYINFIECCLRHKSEMVIYEAAHAIVNLRKTARDLAPAVSVLQLFCGSSKASLRLAGARTLARLTAKHPTAVAACAVDLENLISDPNRSVATLAVTTLLATGAESSVDRLMKQISSFVTEISDEFKIVVVRAIRRLCTKFPRKHQALAAFLAGMLRDEGGLEYKAAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTALAVRILHLLGREGPKSRQPSRYIRFIYNRVILESGPVRAAAVSAVAQFGAQRPELLPNISVLLSRCQMDDEDEVRDRAIYYSAILETGDPQLINDYIVNVPKPNAVLLEKALRDHLATRP--DEPFDMNTVPTEEEPKENKEEIVEIEVKKPIQMSLEELYAEQLSKIVGIERLGPVFKTNQPVDLTEAETEYRVRLLKHIFGRHMILQFECVNTLSDQLLEEVQVRLECPPEYEVKSVTPCPKLVYDKPGNVFVIVEFPSAFLDSLGTFGATLEFVVRDCDPTTGQPDPGEGYADSYPLEEFEIGCSDQIRARAAADDWDQTWERASNAPEASDTFVLSQNDVNEAAKAVCEHLGLPKAAIIGEAVKEIRGGGIFRGGAPVLVRARLAGSSSGVTMKLAARSPREDVAQLLLAAVG 863          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|909575658|ref|XP_013143572.1| (PREDICTED: coatomer subunit gamma [Papilio polytes])

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 597/862 (69.26%), Postives = 717/862 (83.18%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            +RDKKE+ED+ G  +QNLDKT ++QEARYFN TPVNPRKCI+IL+KI+YLL QGEK  T+EATDVFFATTKLFQSK+V+LRR+VYLCIKELS MAQD+IIVTSSLTKDMTGKEDLYR AAIRALC ITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLS++ PDLVRRW+NEAQEA+ S++ MV YHAL +VAG ++ND+LSTVKL+T++  T ++SPY L LLIR+AA++ E D++D +  ++DFIE CLRHKSE+V+YEAAHAIVN  K  + +A AVSVLQ+FCGSSK  LR AGARTLA LTAK P AVA C  DLENLISDPNRSVATLAVTTLLATG ESSIDRLMKQIS F+SEISDEFKI+VV+AIRRLC+K+PRKHQS+ AFLAGMLRDEGG+ +K AIADAII +VEENP+AKETGLAHLCEFIEDCEH++LAVRILH+LGREGPK+RQPSRYIR+IYNRVILESG VRAAAVS VA+FGA RPE+LPNI+VLL RC LDD+DEVRDRAI+Y+AILD+GD QLINDYIINV   NPV LE+AL + +      EETF+I +VP+ EE KE KE  +E+E +K   ++ EE Y E L  +PGIE+ GPIFK  + ++LTEPETEY VR  KHI++RH+ILQFEC+NTL+DQLL +VHVRL  PP Y  +S VPC  L +NK +S+F ++ FP   LDS  +F A+LEFVVRDCDP TG+PD G GY D+YPLEEF+I CADQ + R A +D+E +W  AA++ EASDTF L  +D+ EA  AVC HL LP  ++ GDA+K+I+G G++RGG P+L++A+LVS    VTM+L VRS +  IA  LL+A+G
Sbjct:    5 KRDKKEEEDSGGNPYQNLDKTIVLQEARYFNETPVNPRKCIYILSKILYLLNQGEKFTTKEATDVFFATTKLFQSKNVMLRRMVYLCIKELSTMAQDIIIVTSSLTKDMTGKEDLYRPAAIRALCSITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSSSAPDLVRRWINEAQEAMNSDDPMVCYHALGLVAGLKKNDKLSTVKLITRYFGTSVKSPYMLCLLIRFAAQMVETDDSDNSKRFIDFIEYCLRHKSEMVIYEAAHAIVNLKKPVRDLAPAVSVLQLFCGSSKASLRLAGARTLACLTAKRPTAVAACTVDLENLISDPNRSVATLAVTTLLATGAESSIDRLMKQISSFVSEISDEFKIIVVKAIRRLCTKFPRKHQSIVAFLAGMLRDEGGLDFKAAIADAIIEIVEENPDAKETGLAHLCEFIEDCEHSALAVRILHLLGREGPKSRQPSRYIRFIYNRVILESGPVRAAAVSAVAQFGAQRPEMLPNIKVLLTRCELDDEDEVRDRAIFYNAILDTGDQQLINDYIINVVKLNPVQLERALREHI--ATKPEETFDIMSVPT-EELKEEKEDIVEVEVKKPTQMTTEEVYNEMLSQIPGIERFGPIFKRAQVVELTEPETEYTVRLYKHIFARHIILQFECVNTLNDQLLEQVHVRLDTPPEYNFVSIVPCQRLAFNKSDSVFVVVEFPSAYLDSLGTFGATLEFVVRDCDPNTGIPDPGEGYADSYPLEEFDINCADQIKTRTAAEDFEETWECAANSPEASDTFALPYNDIEEAGKAVCRHLALPNEAVSGDAIKEIKGCGIFRGGAPVLMKAKLVSINVGVTMKLAVRSPREDIAQLLLSAIG 863          
BLAST of HiSeq13204 vs. genbank:protein
Match: gi|512925234|ref|XP_004930789.1| (PREDICTED: coatomer subunit gamma [Bombyx mori])

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 606/862 (70.30%), Postives = 714/862 (82.83%), Query Frame = 0
Query:    3 RRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKIIYLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKNPAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAGARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYLDFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHLRFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGTESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAGMLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAVRILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRPELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIPNPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQPVVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYSRHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESIFYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEFEIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCEHLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRSTQAQIATFLLAAVG 864
            +RD K+++D     +QNLDKT ++QE R FN T V PRKC  ILTKI+YL  QGE   TQEATD FFATTKLFQSK+++LRR+VYLCIKELS +AQDVIIVTSSLTKDMTGKEDLYRAAAIRALC ITD++MLQAIERYMKQAIVDKNPAVSSAALVSALHLS+T PDLVRRW NEAQE I S+NAMVSYHAL V+  +RRND+LSTVKLVT+ S++ ++SPY+L LLIR AA+L + D+++A+  Y+DFIE CLRHKSE+V+YEAAHAIVN  K+ + +A AVSVLQ+FC SSK  LR AGARTLA+LT +HP AVA CA DLENLISD NRSVATLAVTTLLATG ESS+DRLMKQIS F+SEI DEFKI+VV+AIR+LCSK+PRKHQSLAAFLAGMLRDEGG++YK AIADAIIALVEENP+AKETGL+HLCEFIEDCEHT+LAVRILH+LGREGPK+R PSRYIR+IYNRVILESG VRAAAVS VA+FGA  PELLPNI+VLLARC LD++DEVRDRA+YYS IL++ +PQLIND+I+N+P PN VLLEKAL D +      EE FNI +VP+ E  KETK+  +EIE RK   +S EE YAE+L  +PGIEK+GP+FKT   IDLTE E EYRVR VKH+Y+RHVI QFEC+NTL+DQ+L  VHVRL  PP Y + S VPC  L YN Q+++F ++ +P   +DS  SF A+LEFVVRDCDP TG PD G GY D+YPLEEFE+ C+DQ R RA GDDWE +W  AA+  EA+DTF LSQ+DVG+AA AVCEHLGLP  SI GDAVK+IRGGG++R G P+L+RARL  +   VTM+L+ RS +  +A  LLAAVG
Sbjct:    5 KRDVKDEDDNSSNPYQNLDKTIVLQETREFNQTLVIPRKCSLILTKILYLRNQGENFTTQEATDAFFATTKLFQSKEIMLRRMVYLCIKELSKLAQDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDASMLQAIERYMKQAIVDKNPAVSSAALVSALHLSSTAPDLVRRWANEAQETINSDNAMVSYHALGVLVLSRRNDKLSTVKLVTRLSKSHIKSPYSLCLLIRLAAQLCDGDDSEASQPYIDFIECCLRHKSEMVIYEAAHAIVNLRKTARDLAPAVSVLQLFCSSSKAALRLAGARTLARLTTEHPTAVAACAIDLENLISDSNRSVATLAVTTLLATGAESSVDRLMKQISSFVSEIPDEFKIIVVRAIRQLCSKFPRKHQSLAAFLAGMLRDEGGLEYKAAIADAIIALVEENPDAKETGLSHLCEFIEDCEHTALAVRILHLLGREGPKSRHPSRYIRFIYNRVILESGPVRAAAVSAVAQFGAQVPELLPNIKVLLARCQLDEEDEVRDRAVYYSTILETENPQLINDFIVNIPKPNVVLLEKALRDHL---LHPEEPFNILSVPAEEVVKETKKPIVEIEVRKPVQMSIEEIYAEQLAKIPGIEKLGPLFKTNLPIDLTEAEIEYRVRVVKHVYARHVIFQFECVNTLNDQILEDVHVRLEVPPEYEIKSIVPCQKLVYNTQDNVFVVVEYPCAFIDSLGSFMATLEFVVRDCDPNTGTPDPGEGYADSYPLEEFEMGCSDQIRARAGGDDWEQTWERAANVPEANDTFVLSQTDVGDAAKAVCEHLGLPNGSISGDAVKEIRGGGIFRDGAPVLVRARLAGSSAGVTMKLSARSPREDVAQLLLAAVG 863          
The following BLAST results are available for this feature:
BLAST of HiSeq13204 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|112983936|ref|NP_001036846.1|0.000e+079.84nonclathrin coat protein gamma1-COP [Bombyx mori] ... [more]
gi|357622650|gb|EHJ74076.1|0.000e+080.39nonclathrin coat protein gamma1-COP [Danaus plexip... [more]
gi|1073533533|gb|JAT83878.1|0.000e+077.96hypothetical protein g.7051 [Pectinophora gossypie... [more]
gi|913308807|ref|XP_013184959.1|0.000e+079.60PREDICTED: coatomer subunit gamma-like [Amyelois t... [more]
gi|768415665|ref|XP_011548390.1|0.000e+077.87PREDICTED: coatomer subunit gamma-like [Plutella x... [more]
gi|768441171|ref|XP_011562295.1|0.000e+070.65PREDICTED: LOW QUALITY PROTEIN: coatomer subunit g... [more]
gi|1073531041|gb|JAT82632.1|0.000e+074.73hypothetical protein g.19439, partial [Pectinophor... [more]
gi|913331827|ref|XP_013197508.1|0.000e+073.20PREDICTED: coatomer subunit gamma [Amyelois transi... [more]
gi|909575658|ref|XP_013143572.1|0.000e+069.26PREDICTED: coatomer subunit gamma [Papilio polytes... [more]
gi|512925234|ref|XP_004930789.1|0.000e+070.30PREDICTED: coatomer subunit gamma [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006886 intracellular protein transport
biological_process GO:0016192 vesicle-mediated transport
cellular_component GO:0030126 COPI vesicle coat
cellular_component GO:0000139 Golgi membrane
cellular_component GO:0030117 membrane coat
cellular_component GO:0019028 viral capsid
molecular_function GO:0005488 binding
molecular_function GO:0005198 structural molecule activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013040Coatomer, gamma subunit, appendage, Ig-like subdomainPFAMPF08752COP-gamma_platfcoord: 605..753
e-value: 7.3E-46
score: 155.6
IPR013040Coatomer, gamma subunit, appendage, Ig-like subdomainGENE3D2.60.40.1480coord: 599..752
e-value: 1.1E-47
score: 161.3
IPR002553Clathrin/coatomer adaptor, adaptin-like, N-terminalPFAMPF01602Adaptin_Ncoord: 27..535
e-value: 3.2E-122
score: 408.4
IPR017106Coatomer gamma subunitPIRSFPIRSF037093Gamma-COPcoord: 1..864
e-value: 0.0
score: 1052.7
IPR017106Coatomer gamma subunitPANTHERPTHR10261COATOMER SUBUNIT GAMMAcoord: 1..864
IPR015873Clathrin alpha-adaptin/coatomer adaptor, appendage, C-terminal subdomainGENE3D3.30.310.30coord: 761..863
e-value: 1.9E-13
score: 50.0
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 21..585
e-value: 1.8E-120
score: 402.6
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 25..564
IPR009028Coatomer/calthrin adaptor appendage, C-terminal subdomainSUPERFAMILY55711Subdomain of clathrin and coatomer appendage domaincoord: 761..863
IPR013041Coatomer/clathrin adaptor appendage, Ig-like subdomainSUPERFAMILY49348Clathrin adaptor appendage domaincoord: 601..756

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13204HiSeq13204Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13204_p ID=HiSeq13204_p|Name=HiSeq13204|organism=Ostrinia scapulalis|type=polypeptide|length=864bp
MSRRDKKEDEDAVGTIFQNLDKTTLIQEARYFNSTPVNPRKCIHILTKII
YLLYQGEKLGTQEATDVFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDV
IIVTSSLTKDMTGKEDLYRAAAIRALCCITDSTMLQAIERYMKQAIVDKN
PAVSSAALVSALHLSATVPDLVRRWVNEAQEAIMSENAMVSYHALAVVAG
ARRNDRLSTVKLVTKFSRTPLRSPYALTLLIRYAAKLSEEDETDAADGYL
DFIESCLRHKSEIVVYEAAHAIVNSSKSTKAIAHAVSVLQIFCGSSKPHL
RFAGARTLAKLTAKHPNAVADCAPDLENLISDPNRSVATLAVTTLLATGT
ESSIDRLMKQISGFMSEISDEFKIVVVQAIRRLCSKYPRKHQSLAAFLAG
MLRDEGGVQYKTAIADAIIALVEENPEAKETGLAHLCEFIEDCEHTSLAV
RILHVLGREGPKARQPSRYIRYIYNRVILESGAVRAAAVSTVARFGATRP
ELLPNIRVLLARCTLDDDDEVRDRAIYYSAILDSGDPQLINDYIINVPIP
NPVLLEKALEDFVNSGKAEEETFNIAAVPSAEEPKETKETPIEIESRKQP
VVSREEKYAEELKVVPGIEKIGPIFKTCESIDLTEPETEYRVRCVKHIYS
RHVILQFECLNTLSDQLLTRVHVRLCHPPGYRLLSEVPCDVLPYNKQESI
FYLLSFPENPLDSECSFEASLEFVVRDCDPTTGLPDGGSGYTDTYPLEEF
EIRCADQFRLRAAGDDWESSWNAAASADEASDTFGLSQSDVGEAAVAVCE
HLGLPKASIDGDAVKDIRGGGMWRGGNPILLRARLVSAQGAVTMQLTVRS
TQAQIATFLLAAVG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0019028viral capsid
GO:0000139Golgi membrane
GO:0030117membrane coat
GO:0030126COPI vesicle coat
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO:0005198structural molecule activity
Vocabulary: Biological Process
TermDefinition
GO:0016192vesicle-mediated transport
GO:0006886intracellular protein transport
Vocabulary: INTERPRO
TermDefinition
IPR013041Coatomer/clathrin_app_Ig-like
IPR009028Coatomer/calthrin_app_sub_C
IPR016024ARM-type_fold
IPR011989ARM-like
IPR015873Clathrin_a/coatomer_app_sub_C
IPR017106Coatomer_gsu
IPR002553Clathrin/coatomer_adapt-like_N
IPR013040Coatomer_gsu_app_Ig-like-sub