HiSeq13206_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13206
Unique NameHiSeq13206_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length490
Homology
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|930650850|gb|KPI93194.1| (Fatty acid synthase [Papilio xuthus])

HSP 1 Score: 567.77 bits (1462), Expect = 1.769e-180
Identity = 273/490 (55.71%), Postives = 356/490 (72.65%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFID---LSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            ES TISGPA+ M++FV  L  K IFAKEVPCSNIAYHSRYIA AGP LLKYLS+VIK PK RSEKW+STSVP++RW +  A+YSSAEYHTNNLLN VLFEE S+LIP NAVLVEIAPHGLLQAILKRSLP TC ++PLTRR HP+N   +LE +GKL+MEGYNP+V VLYPK+EFPVSTGTP LSHLV+WAH E W +P Y +  + VAA+ K + +VYD E  YL GNV+RG+N +PF AALVAVWD LAMS G +KK++SV++  ++L+ QP+L+ +  L +   LHRG+G+FE+M   +++A GFI    D+ +   EN    ++E+ L   D+YEIL +R + Y  +FQS+++ N++ + A + W+ NWVTFIDG+LQL  L + +D++S P  IR + ID KKH  TQV +    NVM A++  +   T CGG+ +E++KF D   L+K  N    + AL  VP  Q + TD  + + + LQIVA
Sbjct:  678 ESCTISGPADAMKEFVAQLTEKSIFAKEVPCSNIAYHSRYIAKAGPGLLKYLSQVIKSPKRRSEKWMSTSVPQERWNEPIAQYSSAEYHTNNLLNSVLFEETSKLIPANAVLVEIAPHGLLQAILKRSLPETCRHVPLTRRGHPDNVQFLLEAVGKLYMEGYNPKVAVLYPKIEFPVSTGTPMLSHLVEWAHHEKWNIPTYVSAHRIVAASCKSVYSVYDVENEYLTGNVIRGKNTFPFTAALVAVWDLLAMSLGMQKKQLSVQYKDIKLYCQPMLHKQRQLRLFSTLHRGTGYFEIMDEHNRVATGFIKGEIDDDER-PENEFISSEELDLKSEDIYEILKKRGFDYSGEFQSIRKTNKSLTEAQIIWNNNWVTFIDGILQLYVLARSNDSISLPTHIRKMIIDIKKHSETQVDND---NVMTAQVCDILKFTRCGGVIIEDLKFRDLPPLTKEAN----LMALKIVPYFQQNTTDFSTGMLVLLQIVA 1159          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|910329133|ref|XP_013167810.1| (PREDICTED: fatty acid synthase [Papilio xuthus])

HSP 1 Score: 564.688 bits (1454), Expect = 2.758e-179
Identity = 271/490 (55.31%), Postives = 357/490 (72.86%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFID---LSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            ES TISGPA+ M++FV  L  K IFAKEVPCSNIAYHSRYIA AGP LLKYLS+VIK PK RSEKW+STSVP++RW +  A+YSSAEYHTNNLLN VLFEE S+LIP NAVLVEIAPHGLLQAILKRSLP TC ++PLTRR HP+N   +LE +GKL+MEGYNP+V VLYPK+EFPVSTGTP LSHLV+WAH E W +P Y +  + VAA+ K + +VYD E  YL GNV++G+N +PF AALVAVWD LAMS G +KK++SV++  ++L+ QP+L+ +  L +   LHRG+G+FE+M   +++A G+I    D+ +   EN    ++E+ L   D+YEIL +R + Y  +FQS+++ N++ + A + W+ NWVTFIDG+LQL  L + +D++S P  IR + ID KKH  TQV +    NVM A++  +   T CGG+ +E++KF D   L+K  N    + AL  VP  Q + TD  +++ + LQIVA
Sbjct:  678 ESCTISGPADAMKEFVAQLTEKSIFAKEVPCSNIAYHSRYIAKAGPGLLKYLSQVIKSPKRRSEKWMSTSVPQERWNEPIAQYSSAEYHTNNLLNSVLFEETSKLIPANAVLVEIAPHGLLQAILKRSLPETCRHVPLTRRGHPDNVQFLLEAVGKLYMEGYNPKVAVLYPKIEFPVSTGTPMLSHLVEWAHHEKWNIPTYVSAHRIVAASYKSVYSVYDVENEYLTGNVIKGKNTFPFTAALVAVWDLLAMSLGMQKKQLSVQYKDIKLYCQPMLHKQRQLRLFSTLHRGTGYFEIMDEHNRVATGYIKGEIDDDER-PENEFISSEELDLKSEDIYEILKKRGFDYSGEFQSIRKTNKSLTQAQIIWNNNWVTFIDGILQLYVLARSNDSISLPTHIRKMIIDIKKHSETQVDND---NVMTAQVCDILKFTRCGGVIIEDLKFRDLPPLTKEAN----LMALKIVPYFQQNTTDFSTAMLVLLQIVA 1159          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|357614628|gb|EHJ69181.1| (p260 [Danaus plexippus])

HSP 1 Score: 547.74 bits (1410), Expect = 8.064e-177
Identity = 259/487 (53.18%), Postives = 346/487 (71.05%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            +SSTISGPAE+M++FV  L  K IFAKEVPCSNIAYHSRYIA+AGP LLKYL EVI +PK RSE+W+STSVP+DRW +  AKYSSAEYHTNNLLN VLFEE S+LIP NAVL+EIAPHGLLQAILKRSL   C ++PLTRR HP+N   +L+ IGKL+MEGYNP+V  LYPKVEFPVS+GTP LSHLV WAH E W +PLY +  +K AA+ K +++++D+ + YL+GNV+RG NVYPF+A LVAVWDTLAM     K+++S++F+ +    QP+L+D+  L + +++ RG+G FEV     ++A G I  N + +    E+   + K   L   D+Y+ L  R Y Y  DF+S+  +N + S A + W  NWVT ID ++Q+N L++ HD +S P FIR++ ID +KH  T++    G  VM A I      T CGGI +E+I+FID+ K++  ++ + AL FVP +  +  D  ++L  FL +VA
Sbjct:  678 DSSTISGPAEIMKEFVAELTKKDIFAKEVPCSNIAYHSRYIAEAGPGLLKYLKEVIPNPKLRSERWLSTSVPQDRWEEPIAKYSSAEYHTNNLLNSVLFEETSKLIPKNAVLIEIAPHGLLQAILKRSLDENCRHVPLTRRGHPDNAKFLLDAIGKLYMEGYNPKVEALYPKVEFPVSSGTPMLSHLVDWAHHERWNVPLYASAHRKTAASCKFVLSIHDDAHAYLKGNVVRGINVYPFSAVLVAVWDTLAMIMNVPKRQLSIQFNNIHFNTQPILHDQRQLRLNVSIQRGTGRFEVFDENIEVATGTITGNLNSYFNRPEDIIPEEK-TWLDSNDLYKELKTRGYSYSDDFRSIHSSNLSLSSAQLIWKDNWVTIIDSMMQINILKRSHDYISCPNFIRSIAIDVEKHAKTEMVEVDGVTVMNASISEKQDWTRCGGISVEDIQFIDIPKNEK-EIDVKALKFVPHITTNKIDDDTALTCFLHLVA 1162          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|943973688|ref|XP_014368208.1| (PREDICTED: fatty acid synthase [Papilio machaon])

HSP 1 Score: 552.747 bits (1423), Expect = 4.734e-175
Identity = 269/487 (55.24%), Postives = 359/487 (73.72%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            ESSTISGPA+VM++FV  L  K+IFAKEVPCSNIAYHSRYIA AGP LLKY+++VIK PK RS+KWVSTSVP++RW +  A+YSSAEYHTNNLLN VLFEE S+LIPPNAVLVEIAPHGLLQAILKRSLP +C ++PLTRR HP+N   +LE +GKL+MEGYNP+V  LYP++E+PVSTGTP LSHLV+WAH E W +PLY +  + VAA+ K + +VYD E  YL G+V+RG+N  PF +AL+A WD LAMS G  KK++SV+F  V+L+ QP+L+ +  L +   LHRG+G+FE+M   +++A G+I    ++ +    N    ++E+ L   D+YEIL +R + Y  +FQS+Q++N++ + A + W+ NWVTFIDG+LQLN L + HD++S P  IR + ID K+H  TQV +   KNVM A++  +   T CGG+ +E++KF DL  S   +  + AL  VP  Q + TD  +++ I LQIVA
Sbjct:  678 ESSTISGPADVMKEFVAKLTEKQIFAKEVPCSNIAYHSRYIAKAGPGLLKYMNQVIKSPKLRSDKWVSTSVPQERWNEPIAQYSSAEYHTNNLLNSVLFEETSKLIPPNAVLVEIAPHGLLQAILKRSLPESCRHVPLTRRGHPDNVQFLLEAVGKLYMEGYNPKVAALYPQIEYPVSTGTPMLSHLVEWAHHEKWNIPLYVSAHRIVAASCKFVYSVYDVENEYLTGSVIRGKNTLPFTSALIAAWDLLAMSFGLLKKQLSVQFKDVKLYCQPMLHKQRQLRLFATLHRGTGYFEIMDEHNRVATGYIKGEVEDDERSFINEFMSSEELDLKSEDIYEILKKRGFNYSGEFQSIQKSNKSLTEAQIIWNNNWVTFIDGMLQLNILARSHDSISLPTHIRKIIIDIKRHSETQVDN---KNVMTAQVFDILKYTRCGGVVIEDLKFRDLP-SLTKEADLMALKVVPYFQQNTTDFSTAMLILLQIVA 1160          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|930666658|gb|KPJ07769.1| (Fatty acid synthase [Papilio machaon])

HSP 1 Score: 552.362 bits (1422), Expect = 6.155e-175
Identity = 269/487 (55.24%), Postives = 359/487 (73.72%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            ESSTISGPA+VM++FV  L  K+IFAKEVPCSNIAYHSRYIA AGP LLKY+++VIK PK RS+KWVSTSVP++RW +  A+YSSAEYHTNNLLN VLFEE S+LIPPNAVLVEIAPHGLLQAILKRSLP +C ++PLTRR HP+N   +LE +GKL+MEGYNP+V  LYP++E+PVSTGTP LSHLV+WAH E W +PLY +  + VAA+ K + +VYD E  YL G+V+RG+N  PF +AL+A WD LAMS G  KK++SV+F  V+L+ QP+L+ +  L +   LHRG+G+FE+M   +++A G+I    ++ +    N    ++E+ L   D+YEIL +R + Y  +FQS+Q++N++ + A + W+ NWVTFIDG+LQLN L + HD++S P  IR + ID K+H  TQV +   KNVM A++  +   T CGG+ +E++KF DL  S   +  + AL  VP  Q + TD  +++ I LQIVA
Sbjct:  678 ESSTISGPADVMKEFVAKLTEKQIFAKEVPCSNIAYHSRYIAKAGPGLLKYMNQVIKSPKLRSDKWVSTSVPQERWNEPIAQYSSAEYHTNNLLNSVLFEETSKLIPPNAVLVEIAPHGLLQAILKRSLPESCRHVPLTRRGHPDNVQFLLEAVGKLYMEGYNPKVAALYPQIEYPVSTGTPMLSHLVEWAHHEKWNIPLYVSAHRIVAASCKFVYSVYDVENEYLTGSVIRGKNTLPFTSALIAAWDLLAMSFGLLKKQLSVQFKDVKLYCQPMLHKQRQLRLFATLHRGTGYFEIMDEHNRVATGYIKGEVEDDERSFINEFMSSEELDLKSEDIYEILKKRGFNYSGEFQSIQKSNKSLTEAQIIWNNNWVTFIDGMLQLNILARSHDSISLPTHIRKIIIDIKRHSETQVDN---KNVMTAQVFDILKYTRCGGVVIEDLKFRDLP-SLTKEADLMALKVVPYFQQNTTDFSTAMLILLQIVA 1160          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|909551708|ref|XP_013141731.1| (PREDICTED: fatty acid synthase [Papilio polytes])

HSP 1 Score: 550.821 bits (1418), Expect = 1.889e-174
Identity = 265/487 (54.41%), Postives = 357/487 (73.31%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            ESSTISGPA++M++FV  L  K+IFAKEVPCSNIAYHSRYIA AGP LLKYLS+VIK PK RSEKWVSTSVP++RW +  A+YSSAEYHTNNLLN VLFEE S+LIP NAVLVEIAPHGLLQAILKRSLP +C ++PLTRR HP+N   +LE +G+L+MEGYNP V  LYPK+EFPVSTGTP LSHL++WAH E W +PLY +  + VAA+ K + +VYD E  YL G V++G+N +PF AAL+A WD LAMS G  KK++SV+F  ++L+ QP+L+ +  L +   LHRG+G+FE+M   +++A G+I    D+ +    N  T ++E+     D+Y++L +R + Y  +FQS+++AN++ + A + W+ NWVTFIDG+LQLN L + HD++S P  IR + ID K+   TQV S    NVM A +  +   T CGG+ +E++KF DL +    +  + AL  +P  Q ++TDV +++ +FLQIV+
Sbjct:  677 ESSTISGPADIMKEFVAQLTEKQIFAKEVPCSNIAYHSRYIAKAGPGLLKYLSQVIKSPKLRSEKWVSTSVPQERWNEPIAQYSSAEYHTNNLLNSVLFEETSKLIPANAVLVEIAPHGLLQAILKRSLPESCRHVPLTRRGHPDNVQFLLEAVGRLYMEGYNPNVAALYPKIEFPVSTGTPMLSHLIEWAHHEKWNIPLYVSAHRIVAASCKFVYSVYDVENEYLTGCVIKGKNTFPFTAALIAAWDLLAMSLGLLKKQLSVQFKDIKLYCQPMLHQQRQLRLFTTLHRGTGYFEIMDENNRVATGYIKGEVDDERPF-TNEFTSSEELDFKSEDIYDVLKKRGFDYSGEFQSIKKANKSLTEADITWNNNWVTFIDGMLQLNILARSHDSISLPTHIRKIIIDIKRQSETQVGSD---NVMTAEVFDILKYTRCGGVVIEDLKFRDLPQLTK-EADLMALKVIPYFQQNVTDVSTAMLVFLQIVS 1158          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|913332757|ref|XP_013198024.1| (PREDICTED: fatty acid synthase-like, partial [Amyelois transitella])

HSP 1 Score: 521.931 bits (1343), Expect = 5.642e-172
Identity = 251/490 (51.22%), Postives = 344/490 (70.20%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSS-LEIFLQIVAXK 490
            +S TISGP + M+ FV  L  ++IFAKEVPCSNIAYHSRYIA+AGP+L K+LSE+IK PK RS++W+S+SVP D+W + SA+ SSAEYHTNNLL+PVLFEE S+L+P N V++EIAPHGLLQAILKRS+P +C +I +T+R HP+N   VLE IG L++ GY PRV  LYPKVEFPVSTGTPFLS+LV W H E W + LY + Q+   A+ K +V+ +D++Y +L+GNV+RG+ VYP+AAALVAVWDTLAMSTGQ+KK++SV+F+ + L+ QP+L+DR  L I + LHRG+G FEV+ G S +A G+I+      K    +   + +   L   +VY  L +RDY Y  +F S+ + +E  + A + W  NW TFIDGLLQL  L +K D VS+P  IR+++ID K+H    +  +    V++A     H +  CGGI LE++ F D S     ++++ +L FVPR +   +D+ SS L+   Q +  K
Sbjct:  519 DSCTISGPEDAMKKFVEKLTAERIFAKEVPCSNIAYHSRYIAEAGPALRKHLSEIIKSPKARSKRWLSSSVPADKWNEPSAQNSSAEYHTNNLLSPVLFEETSQLLPTNGVMIEIAPHGLLQAILKRSMPESCTHIAMTKRGHPDNVINVLEAIGNLYVAGYVPRVSALYPKVEFPVSTGTPFLSNLVHWMHSEQWGISLYMSAQRNKIASCKFVVSYHDDDYSFLQGNVIRGKTVYPYAAALVAVWDTLAMSTGQKKKQLSVQFNDIHLYAQPILHDRRYLRIHVNLHRGTGMFEVLDGDSLVATGYIVRKIVPVKKNIVHQIPEYEGKMLKSDEVYHQLQKRDYSYSGEFLSIHDMSENCNKAHLLWSNNWTTFIDGLLQLYTLHRKTDGVSEPHLIRSMSIDVKEHFR-NILHADKTTVLEADFVPEHDLMCCGGIMLESVVFRDFSPVVK-EIALKSLKFVPRHRFGESDLSSSHLDAMEQAIRSK 1006          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|768429325|ref|XP_011555838.1| (PREDICTED: fatty acid synthase-like [Plutella xylostella])

HSP 1 Score: 541.576 bits (1394), Expect = 7.855e-171
Identity = 258/493 (52.33%), Postives = 349/493 (70.79%), Query Frame = 0
Query:    1 SESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILE---NKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARI--DALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVA 488
            +ESSTISGP++ MR+FVT L  K IFAKEVPCSNIAYHSRYI +AGP LLKYL+EVIK PK RS++WVSTSV +D+W    AK+SSAEYHTNNLLNPVLFEE S L+P NAV++E+APHGLLQAILKRSLP+TC ++PLTRR HP+N    LE IGKL+MEGYNPR+  LYPKVEFPVSTGTP LSH V+WAH E W +PL+    +++AA+++ I++ YD+E+++L+GNV  GQ +YPF+ ALV VWDTLAMS G  ++K+SV+F  +  + QP + +   L +T  L +GSG+FEVM   +KI +G+I     +K E   I E S  K  +  L  +DVY+I H+R   Y+ DF+S+   NE  + A V W GNWVT +D L+Q+ AL ++++ +S+P F+R + ID K+H         G+N+ +  +       +T CGGI +E++KF D  +     +S+ +L F+P  QL+   VK  L +++QIVA
Sbjct:  678 AESSTISGPSDAMREFVTQLTAKGIFAKEVPCSNIAYHSRYIKEAGPGLLKYLTEVIKSPKERSDRWVSTSVRQDKWDQPYAKFSSAEYHTNNLLNPVLFEETSTLVPSNAVMIEVAPHGLLQAILKRSLPATCTHVPLTRRGHPDNALFFLEAIGKLYMEGYNPRMQALYPKVEFPVSTGTPMLSHHVEWAHHEKWTVPLHIPANRRLAASSQFIISTYDDEHKFLQGNVHEGQTLYPFSGALVCVWDTLAMSQGAMRQKISVQFQNIHFYEQPRIYEDKLLRLTTQLQKGSGYFEVMQENTKIISGYIYSEAIHKQEVPAISEES--KIDDTILPQQDVYKIFHDRGSFYRGDFRSILNINEECTRAQVAWSGNWVTLLDSLVQVQALTREYNGISEPRFVRRIKIDIKEHAQYH---QLGENMNQFEVYNGVKTGVTRCGGIVIEDMKFRDTPRVPPKSISLKSLQFIPFFQLNDIKVKQVLNVYVQIVA 1165          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|913332331|ref|XP_013197786.1| (PREDICTED: fatty acid synthase-like, partial [Amyelois transitella])

HSP 1 Score: 528.094 bits (1359), Expect = 1.529e-169
Identity = 248/486 (51.03%), Postives = 345/486 (70.99%), Query Frame = 0
Query:    2 ESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIV 487
            +S TISGP + M+ FV  L  ++IFAKEVPCSNIAYHSRYIA+AGP+L K+LSE+IK PK RS++W+S+SVP D+W + SA+ SSAEYHTNNLL+PVLFEE S+L+P N V++EIAPHGLLQAILKRS+P +C +I +T+R HP+N   VLE IG L++ GY PRV  LYPKV+FPVSTGTPFLS+LV W H E W + LY + Q+   A+ K +V+ +D++Y +L+GNV+RG+ VYP+AAALVAVWDTLAMSTGQ+KK++ V+F+ + L+ QP+L+DR  L I + LHRG+G FEV+ G S +A G+I+      K    +   + +   L   +VY  L +RDY Y  +F S+ + +E  + A + W  NW TFIDGLLQL  L +K D VS+P  IR+++ID K+H    +  +    V++A     H +  CGGI LE++ F D S     ++++ +L FVPR +   +D+  +L+++LQI+
Sbjct:  461 DSCTISGPEDAMKKFVEKLTAERIFAKEVPCSNIAYHSRYIAEAGPALRKHLSEIIKSPKARSKRWLSSSVPADKWNEPSAQNSSAEYHTNNLLSPVLFEETSQLLPTNGVMIEIAPHGLLQAILKRSMPESCTHIAMTKRGHPDNVINVLEAIGNLYVAGYVPRVSALYPKVDFPVSTGTPFLSNLVHWMHSEQWGISLYMSAQRNKIASCKFVVSYHDDDYSFLQGNVIRGKTVYPYAAALVAVWDTLAMSTGQKKKQLPVQFNDIHLYAQPILHDRRYLRIHVNLHRGTGMFEVLDGDSLVATGYIVRKIVPVKKNIVHQIPEYEGKMLQSDEVYHQLQKRDYSYSGEFLSIHDMSENCNKAHLLWSNNWTTFIDGLLQLYTLHRKTDGVSEPHLIRSMSIDVKEHFR-NILHADKTTVLEADFVPEHDLMCCGGIMLESVVFRDFSPVVK-EIALKSLKFVPRHRFGESDLAETLQVYLQII 944          
BLAST of HiSeq13206 vs. genbank:protein
Match: gi|914577086|gb|KOB78858.1| (Uncharacterized protein OBRU01_01304 [Operophtera brumata])

HSP 1 Score: 513.842 bits (1322), Expect = 1.386e-164
Identity = 258/487 (52.98%), Postives = 333/487 (68.38%), Query Frame = 0
Query:    1 SESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLLKYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLFEEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPALVLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALPLYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDTLAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMHGISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYKSDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFIRTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDLSKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIV 487
            ++S TISGPA+ M+ F++ L  K IFAKEVPCSNIAYHSRYIA+AGP LLKYL E+IK P  RS+KWVSTSVP+DRW +E+AK+SSAEYHTNNLLNPVLFEE S+LIP NAVLVEIAPHGLLQAILKRSLP +C NIPLTRR H ++P +VLE +G+L+MEGY P+V VLYPKVEFPVSTGTPFLS+LV WAH E W +PL+ +  +  AA+ K +V+V+D+E+ YL+G+V+R +   PF+ ALVA WDTLAM+    KK++SV                                 +M G   +  GFI  N D+   ++ +      +  L+ RDVY + +ERDY Y +   +L EAN       + W+ NWVTFIDG+LQLNALR  H+AVS+P+ IR + ID KKHL   +T      ++KA +  +  +T CGG+ +EN+KF DL  SK  ++ +  L FVPR Q S +D+ +SL IF QIV
Sbjct:  501 ADSCTISGPADDMKTFISELVAKGIFAKEVPCSNIAYHSRYIANAGPGLLKYLKEIIKTPTARSDKWVSTSVPQDRWEEEAAKFSSAEYHTNNLLNPVLFEETSKLIPINAVLVEIAPHGLLQAILKRSLPESCTNIPLTRRGHTDSPRMVLEAVGQLYMEGYYPKVQVLYPKVEFPVSTGTPFLSYLVDWAHSEKWTVPLFVSADRMFAASCKFMVSVHDDEHNYLKGHVIRRKTQLPFSYALVAAWDTLAMTLKVPKKQLSV---------------------------------IMDGNMIVTTGFI--NSDDKPVLKSDVQHTEDDFELNSRDVYRLFYERDYAYSN---TLTEAN-------ILWNDNWVTFIDGMLQLNALRHPHNAVSEPSQIRRMVIDVKKHLKYIITKDD-TAIVKAHVSVVSDLTRCGGVLIENLKFHDLPPSKEKQIDLKTLRFVPRFQ-SNSDIFTSLLIFTQIV 940          
The following BLAST results are available for this feature:
BLAST of HiSeq13206 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930650850|gb|KPI93194.1|1.769e-18055.71Fatty acid synthase [Papilio xuthus][more]
gi|910329133|ref|XP_013167810.1|2.758e-17955.31PREDICTED: fatty acid synthase [Papilio xuthus][more]
gi|357614628|gb|EHJ69181.1|8.064e-17753.18p260 [Danaus plexippus][more]
gi|943973688|ref|XP_014368208.1|4.734e-17555.24PREDICTED: fatty acid synthase [Papilio machaon][more]
gi|930666658|gb|KPJ07769.1|6.155e-17555.24Fatty acid synthase [Papilio machaon][more]
gi|909551708|ref|XP_013141731.1|1.889e-17454.41PREDICTED: fatty acid synthase [Papilio polytes][more]
gi|913332757|ref|XP_013198024.1|5.642e-17251.22PREDICTED: fatty acid synthase-like, partial [Amye... [more]
gi|768429325|ref|XP_011555838.1|7.855e-17152.33PREDICTED: fatty acid synthase-like [Plutella xylo... [more]
gi|913332331|ref|XP_013197786.1|1.529e-16951.03PREDICTED: fatty acid synthase-like, partial [Amye... [more]
gi|914577086|gb|KOB78858.1|1.386e-16452.98Uncharacterized protein OBRU01_01304 [Operophtera ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016740 transferase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014043Acyl transferasePFAMPF00698Acyl_transf_1coord: 3..163
e-value: 1.2E-19
score: 70.7
IPR001227Acyl transferase domainGENE3D3.40.366.10coord: 34..146
e-value: 2.3E-8
score: 33.4
NoneNo IPR availablePANTHERPTHR11712:SF227FATTY ACID SYNTHASEcoord: 5..446
NoneNo IPR availablePANTHERPTHR11712POLYKETIDE SYNTHASE-RELATEDcoord: 5..446
IPR016035Acyl transferase/acyl hydrolase/lysophospholipaseSUPERFAMILY52151FabD/lysophospholipase-likecoord: 27..133

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13206HiSeq13206Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13206_p ID=HiSeq13206_p|Name=HiSeq13206|organism=Ostrinia scapulalis|type=polypeptide|length=490bp
SESSTISGPAEVMRDFVTSLANKKIFAKEVPCSNIAYHSRYIADAGPSLL
KYLSEVIKDPKPRSEKWVSTSVPEDRWGDESAKYSSAEYHTNNLLNPVLF
EEASRLIPPNAVLVEIAPHGLLQAILKRSLPSTCNNIPLTRRAHPNNPAL
VLEGIGKLFMEGYNPRVHVLYPKVEFPVSTGTPFLSHLVQWAHGEIWALP
LYKTIQKKVAAAAKQIVTVYDEEYRYLRGNVLRGQNVYPFAAALVAVWDT
LAMSTGQEKKKVSVKFSKVELFVQPLLNDRTSLTITIALHRGSGWFEVMH
GISKIANGFILENKDEFKTIEENSTTKNKEITLSCRDVYEILHERDYCYK
SDFQSLQEANETFSGAAVKWDGNWVTFIDGLLQLNALRQKHDAVSQPAFI
RTLTIDTKKHLSTQVTSSQGKNVMKARIDALHSITSCGGIQLENIKFIDL
SKSKNYKLSINALTFVPRLQLSMTDVKSSLEIFLQIVAXK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR016035Acyl_Trfase/lysoPLipase
IPR001227Ac_transferase_dom
IPR014043Acyl_transferase