HiSeq13207_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13207
Unique NameHiSeq13207_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length69
Homology
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|909551708|ref|XP_013141731.1| (PREDICTED: fatty acid synthase [Papilio polytes])

HSP 1 Score: 99.3673 bits (246), Expect = 9.445e-23
Identity = 43/68 (63.24%), Postives = 54/68 (79.41%), Query Frame = 0
Query:    2 IGVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            +G++P V  +  + +GMDFSGVT+ G RVMG+VPSG+ S R+   P+LLWPVPDHWTMEEAATVPL Y
Sbjct: 1439 LGIIPRVGKD--SCFGMDFSGVTESGERVMGLVPSGAVSSRVLADPKLLWPVPDHWTMEEAATVPLAY 1504          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|910329133|ref|XP_013167810.1| (PREDICTED: fatty acid synthase [Papilio xuthus])

HSP 1 Score: 97.4413 bits (241), Expect = 4.797e-22
Identity = 41/68 (60.29%), Postives = 54/68 (79.41%), Query Frame = 0
Query:    2 IGVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            +G++P V ++  N +GMDFSGVT+ G RVMG++PSG+ S ++   P LLWPVPDHWT+EEAATVPL Y
Sbjct: 1439 LGIIPNVGND--NCFGMDFSGVTESGERVMGVLPSGAISSQVLADPNLLWPVPDHWTLEEAATVPLAY 1504          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|930650850|gb|KPI93194.1| (Fatty acid synthase [Papilio xuthus])

HSP 1 Score: 97.0561 bits (240), Expect = 6.423e-22
Identity = 41/68 (60.29%), Postives = 54/68 (79.41%), Query Frame = 0
Query:    2 IGVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            +G++P V +E  N +GMDFSGVT+ G RVMG++PSG+ S ++   P LLWPVP+HWT+EEAATVPL Y
Sbjct: 1439 LGIIPNVGNE--NCFGMDFSGVTESGERVMGVLPSGAISSQVLADPNLLWPVPEHWTLEEAATVPLAY 1504          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|943973688|ref|XP_014368208.1| (PREDICTED: fatty acid synthase [Papilio machaon])

HSP 1 Score: 95.5153 bits (236), Expect = 1.948e-21
Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 0
Query:    3 GVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            G++P V  E  N +GMDFSGVT+ G RVMG++PSG+ S  +   P+LLWPVP+HWT+EEAATVPL Y
Sbjct: 1442 GIIPRVGKE--NCFGMDFSGVTESGERVMGVLPSGALSSHVLADPKLLWPVPEHWTLEEAATVPLAY 1506          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|930666658|gb|KPJ07769.1| (Fatty acid synthase [Papilio machaon])

HSP 1 Score: 95.5153 bits (236), Expect = 1.986e-21
Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 0
Query:    3 GVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            G++P V  E  N +GMDFSGVT+ G RVMG++PSG+ S  +   P+LLWPVP+HWT+EEAATVPL Y
Sbjct: 1442 GIIPRVGKE--NCFGMDFSGVTESGERVMGVLPSGALSSHVLADPKLLWPVPEHWTLEEAATVPLAY 1506          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|768429333|ref|XP_011555843.1| (PREDICTED: fatty acid synthase-like [Plutella xylostella])

HSP 1 Score: 93.9745 bits (232), Expect = 8.058e-21
Identity = 43/70 (61.43%), Postives = 53/70 (75.71%), Query Frame = 0
Query:    1 AIGV-LPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            A+GV +P +  +    YGMDFSGVT+ G RVMGIV  G+AS RL   P LLWPVP+HW++E+AATVPLPY
Sbjct: 1194 ALGVNVPQLLQKSDLGYGMDFSGVTNNGERVMGIVRGGAASTRLAADPSLLWPVPEHWSLEDAATVPLPY 1263          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|768429327|ref|XP_011555839.1| (PREDICTED: fatty acid synthase-like isoform X1 [Plutella xylostella])

HSP 1 Score: 92.8189 bits (229), Expect = 1.916e-20
Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 0
Query:   16 YGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            YGMDFSGVTD  VRVMG+V  GSAS R+   P +LWPVP+HW++E+AATVPLPY
Sbjct: 1216 YGMDFSGVTDNSVRVMGVVRGGSASTRVAADPAMLWPVPEHWSLEDAATVPLPY 1269          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|768429329|ref|XP_011555840.1| (PREDICTED: fatty acid synthase-like isoform X2 [Plutella xylostella])

HSP 1 Score: 92.8189 bits (229), Expect = 1.954e-20
Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 0
Query:   16 YGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            YGMDFSGVTD  VRVMG+V  GSAS R+   P +LWPVP+HW++E+AATVPLPY
Sbjct: 1212 YGMDFSGVTDNSVRVMGVVRGGSASTRVAADPAMLWPVPEHWSLEDAATVPLPY 1265          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|768429331|ref|XP_011555842.1| (PREDICTED: fatty acid synthase-like [Plutella xylostella])

HSP 1 Score: 90.1225 bits (222), Expect = 1.495e-19
Identity = 38/54 (70.37%), Postives = 44/54 (81.48%), Query Frame = 0
Query:   16 YGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            YGMDFSG T  GVRVMGIV  G+AS RL   P LLWPVP+HW++E+AATVP+PY
Sbjct: 1210 YGMDFSGKTKSGVRVMGIVRGGAASTRLAADPSLLWPVPNHWSLEDAATVPMPY 1263          
BLAST of HiSeq13207 vs. genbank:protein
Match: gi|768429323|ref|XP_011555837.1| (PREDICTED: fatty acid synthase-like [Plutella xylostella])

HSP 1 Score: 88.1965 bits (217), Expect = 8.065e-19
Identity = 36/61 (59.02%), Postives = 45/61 (73.77%), Query Frame = 0
Query:    9 NSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLLWPVPDHWTMEEAATVPLPY 69
            N     +YGMDFSG+   G RVMG++  G+AS R+   P LLWPVPDHW++E+AATVPLPY
Sbjct: 1452 NEVSDQNYGMDFSGLNANGERVMGVIYGGAASTRVAADPSLLWPVPDHWSLEDAATVPLPY 1512          
The following BLAST results are available for this feature:
BLAST of HiSeq13207 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909551708|ref|XP_013141731.1|9.445e-2363.24PREDICTED: fatty acid synthase [Papilio polytes][more]
gi|910329133|ref|XP_013167810.1|4.797e-2260.29PREDICTED: fatty acid synthase [Papilio xuthus][more]
gi|930650850|gb|KPI93194.1|6.423e-2260.29Fatty acid synthase [Papilio xuthus][more]
gi|943973688|ref|XP_014368208.1|1.948e-2161.19PREDICTED: fatty acid synthase [Papilio machaon][more]
gi|930666658|gb|KPJ07769.1|1.986e-2161.19Fatty acid synthase [Papilio machaon][more]
gi|768429333|ref|XP_011555843.1|8.058e-2161.43PREDICTED: fatty acid synthase-like [Plutella xylo... [more]
gi|768429327|ref|XP_011555839.1|1.916e-2070.37PREDICTED: fatty acid synthase-like isoform X1 [Pl... [more]
gi|768429329|ref|XP_011555840.1|1.954e-2070.37PREDICTED: fatty acid synthase-like isoform X2 [Pl... [more]
gi|768429331|ref|XP_011555842.1|1.495e-1970.37PREDICTED: fatty acid synthase-like [Plutella xylo... [more]
gi|768429323|ref|XP_011555837.1|8.065e-1959.02PREDICTED: fatty acid synthase-like [Plutella xylo... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0003824 catalytic activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011032GroES (chaperonin 10)-likeGENE3D3.90.180.10coord: 14..68
e-value: 8.9E-6
score: 25.2
IPR011032GroES (chaperonin 10)-likeSUPERFAMILY50129GroES-likecoord: 15..68

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13207HiSeq13207Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13207_p ID=HiSeq13207_p|Name=HiSeq13207|organism=Ostrinia scapulalis|type=polypeptide|length=69bp
AIGVLPTVNSEVQNSYGMDFSGVTDRGVRVMGIVPSGSASKRLKGLPQLL
WPVPDHWTMEEAATVPLPY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR011032GroES-like