HiSeq13232_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13232
Unique NameHiSeq13232_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length339
Homology
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|913313421|ref|XP_013187487.1| (PREDICTED: SUMO-activating enzyme subunit 1 [Amyelois transitella])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 317/339 (93.51%), Postives = 332/339 (97.94%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENN++ELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGL+GLGAE AKNIILSGVKSVCLLDNEKLKEIDLYSQFL PPDKVGEN+AEASLQRARALNPMV+VT+ETKAVDDLPDEYFTTFDIVCATGLKQEQLERINN CRDSNKKFLCGDVWGM+GYMFADLVDHEYSEEI+QHKA KRGPDD+EKSARETV+ITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KILLRFRD+YNRNPDPAKRKADTEILLKMR+ELVKEL+LP GFVSDALL DVFG V+GAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNDIELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLTGLGAETAKNIILSGVKSVCLLDNEKLKEIDLYSQFLTPPDKVGENRAEASLQRARALNPMVEVTAETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNVCRDSNKKFLCGDVWGMFGYMFADLVDHEYSEEIIQHKAAKRGPDDNEKSARETVTITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILLRFRDDYNRNPDPAKRKADTEILLKMRDELVKELSLPAGFVSDALLTDVFGTVSGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|930662251|gb|KPJ04047.1| (SUMO-activating enzyme subunit 1 [Papilio xuthus])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 308/339 (90.86%), Postives = 327/339 (96.46%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENNE+ELSEAEAEQYDRQIRLWGL+SQKRLRASKVLIIGLSGLGAE AKNIILSGVKSVCL DNE LKEIDLYSQFLAPPDK+GEN+AEASL RA+ALNPMVD+T+ETKAVD LPD +FTTFDIVCATGLKQEQLERINN CRD NKKFLCGDVWGM+GYMFADLVDH+YSEEIVQH+AVKRGPDD+EKS   TVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KILLRFRDEYNRNPDPAKRKADTEILL+MR+ELVKEL+LPVGF+SDALL DVFGIV+GAAAVVGGVIGQEVVKA+SQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNEIELSEAEAEQYDRQIRLWGLDSQKRLRASKVLIIGLSGLGAETAKNIILSGVKSVCLQDNEVLKEIDLYSQFLAPPDKIGENRAEASLVRAKALNPMVDITTETKAVDSLPDSFFTTFDIVCATGLKQEQLERINNICRDKNKKFLCGDVWGMFGYMFADLVDHQYSEEIVQHRAVKRGPDDTEKSGAATVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILLRFRDEYNRNPDPAKRKADTEILLRMRDELVKELSLPVGFISDALLTDVFGIVSGAAAVVGGVIGQEVVKAMSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|910319975|ref|XP_013162856.1| (PREDICTED: SUMO-activating enzyme subunit 1 [Papilio xuthus])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 307/339 (90.56%), Postives = 327/339 (96.46%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENNE+ELSEAEAEQYDRQIRLWGL+SQKRLRASKVLIIGLSGLGAE AKNIILSGVKSVCL DNE LKEIDLYSQFLAPPDK+GEN+AEASL RA+ALNPMVD+T+ETKAVD LPD +FTTFDIVCATGLKQEQLERINN CRD NKKFLCGDVWGM+GYMFADLVDH+YSEEIVQH+AVKRGPDD+EKS   TVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KILLRFRDEYNRNPDPA+RKADTEILL+MR+ELVKEL+LPVGF+SDALL DVFGIV+GAAAVVGGVIGQEVVKA+SQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNEIELSEAEAEQYDRQIRLWGLDSQKRLRASKVLIIGLSGLGAETAKNIILSGVKSVCLQDNEVLKEIDLYSQFLAPPDKIGENRAEASLVRAKALNPMVDITTETKAVDSLPDSFFTTFDIVCATGLKQEQLERINNICRDKNKKFLCGDVWGMFGYMFADLVDHQYSEEIVQHRAVKRGPDDTEKSGAATVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILLRFRDEYNRNPDPARRKADTEILLRMRDELVKELSLPVGFISDALLTDVFGIVSGAAAVVGGVIGQEVVKAMSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|914569188|gb|KOB72901.1| (SUMO-1 activating enzyme [Operophtera brumata])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 309/339 (91.15%), Postives = 327/339 (96.46%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGL+GLGAE AKNIILSGVKSVCLLDNEKLKEIDLY+QFLAPPDKVGEN+AEASLQRARALNPMVDVT+ETKAVD+LPD YFT +D+VCATGLKQEQLERINNACRDSNKKFLCGDVWG YGYMFADLVDHEYSEEIVQHKAVKRGPDD+EK+A +TVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KILLRFRDEYNRNPDPAKRKAD EI+++MR+ELVKELNL  GF+S+ALL DVFG V+GAAAVVGGVI QEVVKAVSQREPPHNNMFFFNP KCVGFVELYGQ
Sbjct:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLAGLGAETAKNIILSGVKSVCLLDNEKLKEIDLYAQFLAPPDKVGENRAEASLQRARALNPMVDVTAETKAVDELPDSYFTQYDVVCATGLKQEQLERINNACRDSNKKFLCGDVWGTYGYMFADLVDHEYSEEIVQHKAVKRGPDDTEKNACQTVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILLRFRDEYNRNPDPAKRKADYEIIMRMRDELVKELNLSAGFISNALLYDVFGTVSGAAAVVGGVIAQEVVKAVSQREPPHNNMFFFNPSKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|909563597|ref|XP_013137029.1| (PREDICTED: SUMO-activating enzyme subunit 1 [Papilio polytes])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 303/339 (89.38%), Postives = 327/339 (96.46%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENNE+ELSEAEAEQYDRQIRLWGL+SQKRLRASKVLIIGLSGLGAE AKN+ILSGVKSVCL DNE LKEIDLYSQFLAPPDK+GEN+AEASLQRA+ALNPMVD+T+ETKAVD LPD +FT+FDIVCATGLKQEQLERINN CRD NKKFLCGDVWGM+GYMFADLVDH+YSEEIVQH+ VKRGPDD+EKS   TVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+K+LLRFRDEYNRNPDPAKRKADTE+LL+MR+ELVKEL+LPVGF+SDALL DVFGI++GAAAVVGGVIGQEVVKA+SQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNEIELSEAEAEQYDRQIRLWGLDSQKRLRASKVLIIGLSGLGAETAKNVILSGVKSVCLQDNEVLKEIDLYSQFLAPPDKIGENRAEASLQRAKALNPMVDITTETKAVDSLPDSFFTSFDIVCATGLKQEQLERINNICRDKNKKFLCGDVWGMFGYMFADLVDHQYSEEIVQHRPVKRGPDDTEKSGAATVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKVLLRFRDEYNRNPDPAKRKADTEVLLRMRDELVKELSLPVGFISDALLTDVFGILSGAAAVVGGVIGQEVVKAMSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|943967998|ref|XP_014365919.1| (PREDICTED: SUMO-activating enzyme subunit 1 [Papilio machaon] >gi|930668556|gb|KPJ09562.1| SUMO-activating enzyme subunit 1 [Papilio machaon])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 305/339 (89.97%), Postives = 325/339 (95.87%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENNE+ELSEAEAEQYDRQIRLWGL+SQKRLRASKVLIIGLSGLGAE AKNIILSGVKSVCL DNE LKEIDLYSQFLAPPDK+GEN+AEASL RA+ALNPMVD+T+ETKAVD LPD +FT+FDIVCATGLKQEQLERINN CRD NKKFLCGDVWGM+GYMFADLVDH+YSEEIVQH+AVKRGPDD+EKS   TVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KILLRFRDEYNRNPDPAKRKADTE+LL MR+ELVKEL+LPVGF+SDAL  DVFGIV+GAAAVVGGVIGQEVVKA+SQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNEIELSEAEAEQYDRQIRLWGLDSQKRLRASKVLIIGLSGLGAETAKNIILSGVKSVCLQDNEVLKEIDLYSQFLAPPDKIGENRAEASLVRAKALNPMVDITTETKAVDSLPDSFFTSFDIVCATGLKQEQLERINNICRDKNKKFLCGDVWGMFGYMFADLVDHQYSEEIVQHRAVKRGPDDTEKSGAATVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILLRFRDEYNRNPDPAKRKADTEVLLCMRDELVKELSLPVGFISDALFTDVFGIVSGAAAVVGGVIGQEVVKAMSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|768440414|ref|XP_011561879.1| (PREDICTED: LOW QUALITY PROTEIN: origin recognition complex subunit 1 [Plutella xylostella])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 290/337 (86.05%), Postives = 316/337 (93.77%), Query Frame = 0
Query:    5 NEVELSEA--EAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            N ++L E   EAEQYDRQIRLWGLESQKRLRASKVLIIGL+GLGAE AKNIILSGVKSV L D+EKLKE+DLYSQFL PPDK+G N+AEASLQRARALNPMVD+++ETK VD+LPD +F  FDIVCATGLKQEQLERINN CRD+NKKFLCGDVWGM+GYMFADLVDHEYSEEIVQHKAVKRGPDD EK+ARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFV+KIL RFRDEYNRNP+PA+RKADTEIL KMR+ELVKEL+LP GFVS++LL DVFG+V+GAAAVVGGVIGQEVVKAVSQ+EPPHNNMFFFNP+K VGFVELYGQ
Sbjct:  587 NTMDLPERALEAEQYDRQIRLWGLESQKRLRASKVLIIGLNGLGAETAKNIILSGVKSVVLQDHEKLKEVDLYSQFLTPPDKIGGNRAEASLQRARALNPMVDISAETKGVDELPDSFFAQFDIVCATGLKQEQLERINNVCRDNNKKFLCGDVWGMFGYMFADLVDHEYSEEIVQHKAVKRGPDDEEKTARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVMKILSRFRDEYNRNPEPAQRKADTEILFKMRDELVKELSLPAGFVSNSLLTDVFGVVSGAAAVVGGVIGQEVVKAVSQKEPPHNNMFFFNPIKGVGFVELYGQ 923          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|509177691|gb|JAA86966.1| (SUMO-1 activating enzyme [Pararge aegeria])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 307/339 (90.56%), Postives = 325/339 (95.87%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MVENN VELSEAEAEQYDRQIRLWGLESQKR+R+SKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKE DL+SQFLAP DK+GEN+AE SLQRARALNPMV+VT+ETKAV+ LPD YF TFD+VCATGLKQEQLERINN CRD   KFLCGDVWGM+GYMFADL DHEYSEEIVQHKAVKRGPDDSEK+ARETV+I VKRRAIYVPLQNALSADW+KPELRSRLRRGDPSYFV+KILLRFRDEYNRNPDPAKRK+DTEILL+MR+ELVKELNLPVGFVSDA+L DVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ
Sbjct:    1 MVENNGVELSEAEAEQYDRQIRLWGLESQKRIRSSKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKETDLHSQFLAPSDKIGENRAETSLQRARALNPMVEVTAETKAVEALPDSYFGTFDVVCATGLKQEQLERINNICRDKTNKFLCGDVWGMFGYMFADLFDHEYSEEIVQHKAVKRGPDDSEKNARETVTINVKRRAIYVPLQNALSADWTKPELRSRLRRGDPSYFVMKILLRFRDEYNRNPDPAKRKSDTEILLRMRDELVKELNLPVGFVSDAILTDVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|357620824|gb|EHJ72871.1| (SUMO-1 activating enzyme [Danaus plexippus])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 278/317 (87.70%), Postives = 299/317 (94.32%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREP 317
            MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIG+SGLGAEIAKNIILSGVKSVCLLD+EKLKE DLYSQFLAPPDK+GEN+AE SLQRARALNPMVDVT+ETKAVDDLPD YF TFDI+CATGLKQEQLER+NN CRD+NKKFLCGDVWG +GYMFADL+DHEYSEEIVQHKAVKRGPDD+E +ARETVSITVKRRAIYVPLQNALS DW+KPELRSRLRRGDPSYFV+KIL RFRDEYNRNPDPA+RK +TEILL+MR+ELVKEL+LP GF+ DALL DVFGIV+GAAAVVGGVI QEVVKA   R P
Sbjct:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGMSGLGAEIAKNIILSGVKSVCLLDSEKLKETDLYSQFLAPPDKIGENRAETSLQRARALNPMVDVTAETKAVDDLPDSYFATFDIICATGLKQEQLERVNNICRDNNKKFLCGDVWGTFGYMFADLIDHEYSEEIVQHKAVKRGPDDNEANARETVSITVKRRAIYVPLQNALSVDWTKPELRSRLRRGDPSYFVMKILSRFRDEYNRNPDPAQRKTETEILLRMRDELVKELSLPAGFIKDALLTDVFGIVSGAAAVVGGVIAQEVVKASIARFP 317          
BLAST of HiSeq13232 vs. genbank:protein
Match: gi|114052607|ref|NP_001040485.1| (SUMO-1 activating enzyme [Bombyx mori] >gi|95103086|gb|ABF51484.1| SUMO-1 activating enzyme [Bombyx mori])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 281/339 (82.89%), Postives = 312/339 (92.04%), Query Frame = 0
Query:    1 MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIAKNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARALNPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKKFLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSITVKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRNPDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVVGGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ 339
            MV NNEVELSEAEAEQYDRQIRLWGL+SQKRLRA+KVLIIGLSGLGAEIAKN+IL+GVKSVCLLDNEKLK+IDLYSQFL PPDK+G N+AE SL+RAR LNPMVDVTS TK VD+LPD +FT FD+VCATGLKQEQ ERINNACRDSNKKF+CGDVWG YGYMF+DLVDHEYSEEIVQHKA KRGPDD EK+ARETVSITVKRRAIYVPLQNALSADW+ PE+RSRLRRGD  YF +K+LLRFRDEYNRNPDPA+RK D  +LLKMR+E+V+EL+LP  F+ D+L  DVFG+VA AAAV+GGVIGQEVVKAVSQREPPHNNMFFFNP+KC+G+ ELYGQ
Sbjct:    1 MVGNNEVELSEAEAEQYDRQIRLWGLDSQKRLRAAKVLIIGLSGLGAEIAKNVILTGVKSVCLLDNEKLKQIDLYSQFLCPPDKIGVNRAEGSLERARGLNPMVDVTSHTKGVDELPDSFFTEFDVVCATGLKQEQFERINNACRDSNKKFICGDVWGTYGYMFSDLVDHEYSEEIVQHKATKRGPDDEEKNARETVSITVKRRAIYVPLQNALSADWNSPEMRSRLRRGDCGYFAMKLLLRFRDEYNRNPDPARRKDDINLLLKMRDEIVRELSLPASFIKDSLFYDVFGVVAAAAAVIGGVIGQEVVKAVSQREPPHNNMFFFNPIKCLGYTELYGQ 339          
The following BLAST results are available for this feature:
BLAST of HiSeq13232 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913313421|ref|XP_013187487.1|0.000e+093.51PREDICTED: SUMO-activating enzyme subunit 1 [Amyel... [more]
gi|930662251|gb|KPJ04047.1|0.000e+090.86SUMO-activating enzyme subunit 1 [Papilio xuthus][more]
gi|910319975|ref|XP_013162856.1|0.000e+090.56PREDICTED: SUMO-activating enzyme subunit 1 [Papil... [more]
gi|914569188|gb|KOB72901.1|0.000e+091.15SUMO-1 activating enzyme [Operophtera brumata][more]
gi|909563597|ref|XP_013137029.1|0.000e+089.38PREDICTED: SUMO-activating enzyme subunit 1 [Papil... [more]
gi|943967998|ref|XP_014365919.1|0.000e+089.97PREDICTED: SUMO-activating enzyme subunit 1 [Papil... [more]
gi|768440414|ref|XP_011561879.1|0.000e+086.05PREDICTED: LOW QUALITY PROTEIN: origin recognition... [more]
gi|509177691|gb|JAA86966.1|0.000e+090.56SUMO-1 activating enzyme [Pararge aegeria][more]
gi|357620824|gb|EHJ72871.1|0.000e+087.70SUMO-1 activating enzyme [Danaus plexippus][more]
gi|114052607|ref|NP_001040485.1|0.000e+082.89SUMO-1 activating enzyme [Bombyx mori] >gi|9510308... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006464 cellular protein modification process
molecular_function GO:0008641 small protein activating enzyme activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000011Ubiquitin/SUMO-activating enzyme E1PRINTSPR01849UBIQUITINACTcoord: 38..62
score: 69.5
coord: 154..181
score: 17.71
IPR000594UBA/THIF-type NAD/FAD binding foldPFAMPF00899ThiFcoord: 34..163
e-value: 1.3E-18
score: 67.0
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 5..334
e-value: 2.4E-72
score: 243.2
NoneNo IPR availablePANTHERPTHR10953:SF142SUMO-ACTIVATING ENZYME SUBUNIT 1coord: 3..335
NoneNo IPR availablePANTHERPTHR10953UBIQUITIN-ACTIVATING ENZYME E1coord: 3..335
IPR009036Molybdenum cofactor biosynthesis, MoeBSUPERFAMILY69572Activating enzymes of the ubiquitin-like proteinscoord: 10..335

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13232HiSeq13232Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13232_p ID=HiSeq13232_p|Name=HiSeq13232|organism=Ostrinia scapulalis|type=polypeptide|length=339bp
MVENNEVELSEAEAEQYDRQIRLWGLESQKRLRASKVLIIGLSGLGAEIA
KNIILSGVKSVCLLDNEKLKEIDLYSQFLAPPDKVGENKAEASLQRARAL
NPMVDVTSETKAVDDLPDEYFTTFDIVCATGLKQEQLERINNACRDSNKK
FLCGDVWGMYGYMFADLVDHEYSEEIVQHKAVKRGPDDSEKSARETVSIT
VKRRAIYVPLQNALSADWSKPELRSRLRRGDPSYFVLKILLRFRDEYNRN
PDPAKRKADTEILLKMRNELVKELNLPVGFVSDALLADVFGIVAGAAAVV
GGVIGQEVVKAVSQREPPHNNMFFFNPVKCVGFVELYGQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006464cellular protein modification process
Vocabulary: Molecular Function
TermDefinition
GO:0008641small protein activating enzyme activity
Vocabulary: INTERPRO
TermDefinition
IPR009036Molybdenum_cofac_synth_MoeB
IPR016040NAD(P)-bd_dom
IPR000594ThiF_NAD_FAD-bd
IPR000011UBQ/SUMO-activ_enz_E1-like