HiSeq13236_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13236
Unique NameHiSeq13236_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length197
Homology
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|930652477|gb|KPI94816.1| (Gamma-interferon-inducible lysosomal thiol reductase [Papilio xuthus])

HSP 1 Score: 147.517 bits (371), Expect = 6.753e-41
Identity = 74/189 (39.15%), Postives = 113/189 (59.79%), Query Frame = 0
Query:    8 VLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYSLLK-YTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCKD 195
            VL+ ++YE +CPGCRQF T     +I KLG ++++ T PYG A TT   NG     CQHG  ECYGNKLH CA         + + +++ FN CLM       GS+D A D CG+++N+     + +K CAKS+ GD + ++ G+ S  + +  +P++ +  +   G  ++L+KD+C++F NPP PC D
Sbjct:   60 VLLQVYYECLCPGCRQFYTEKLKPVIEKLGQYINIKTYPYGNARTTIDENGNYKIDCQHGPPECYGNKLHACAINLL-----QNKTQALLFNACLMTQRGDSRGSDDKAADACGTELNLD---ASPVKECAKSNKGDELLKYYGDESKKQNFNYVPYILIQGQVNNG--QELMKDICSVFTNPPPPCND 238          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|910346569|ref|XP_013177197.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Papilio xuthus])

HSP 1 Score: 145.976 bits (367), Expect = 2.722e-40
Identity = 73/189 (38.62%), Postives = 112/189 (59.26%), Query Frame = 0
Query:    8 VLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYSLLK-YTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCKD 195
            VL+ ++YE +CPGCRQF T     +I KLG ++++ T PYG A T    NG     CQHG  ECYGNKLH CA         + + +++ FN CLM       GS+D A D CG+++N+     + +K CAKS+ GD + ++ G+ S  + +  +P++ +  +   G  ++L+KD+C++F NPP PC D
Sbjct:   60 VLLQVYYECLCPGCRQFYTEKLKPVIEKLGQYINIKTYPYGNARTIIDENGNYKIECQHGPPECYGNKLHACAINLL-----QNKTQALLFNACLMTQRGDSRGSDDKAADACGTELNLD---ASPVKECAKSNKGDELLKYYGDESKKQNFNYVPYILIQGQVNNG--QELMKDICSVFTNPPPPCND 238          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|943945889|ref|XP_014356162.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Papilio machaon])

HSP 1 Score: 145.206 bits (365), Expect = 7.082e-40
Identity = 75/189 (39.68%), Postives = 108/189 (57.14%), Query Frame = 0
Query:    8 VLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYS-LLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCKD 195
            VLV ++YE++CP CR F T     ++ KLG ++++ T PYG A T    NG  T  CQHG  ECYGNKLH CA         + + +++ FN CLM    +  GS+D A D CG+++N+       IK CAKS+ GD + +  GE S    +  +P++ +      G  E+L+KD+C +F NPP PC D
Sbjct:   61 VLVQVYYESLCPACRLFFTDQLKPVVEKLGQYINIRTYPYGNAKTIIDENGDYTIKCQHGPPECYGNKLHACALNLL-----QNKTQALIFNACLMTRRPNSRGSDDKAADACGTELNLDSNT---IKECAKSNKGDELLKHYGEESKKANFNYVPYILIQGRVNDG--EELMKDICNVFTNPPPPCND 239          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|909559582|ref|XP_013134852.1| (PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like [Papilio polytes])

HSP 1 Score: 139.813 bits (351), Expect = 7.182e-38
Identity = 72/191 (37.70%), Postives = 110/191 (57.59%), Query Frame = 0
Query:    4 SKEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLG-EYSLLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPC 193
            SKE V++ +FYE++ P C+ F       ++ KL +++ V+T P+G A     + G + F CQHG  ECYGNKLH C              +++ FNTC+M L+   +GS+D + D CG    +     A+IK CAKS  GD +F+F G E + + Y ++P+V +N  P+ G  E+L+++VCA F  PP  C
Sbjct:   57 SKERVVIQVFYESLSPECKTFHKHILMPVVQKLNNNIRVMTYPFGNAQVVN-HQGHVEFKCQHGPEECYGNKLHACTLALMGNRT-----QALVFNTCMMSLKGHSHGSDDHSADVCGKTYKVDT---ASIKECAKSSTGDELFKFFGDESTKVNYRNVPYVLINGRPYKG--ENLMRNVCAAFNKPPVVC 236          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|909559510|ref|XP_013134813.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Papilio polytes])

HSP 1 Score: 139.043 bits (349), Expect = 1.492e-37
Identity = 72/193 (37.31%), Postives = 109/193 (56.48%), Query Frame = 0
Query:    6 EIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYS-LLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCKDVK 197
            + VL+ ++YE+ CP C QF T     +I  LG ++ + T PYG A T    NG     CQHG  ECYGNKLH CA         + + +++ FN+CLM   ++  GS+D A D CG+++N+       IK CAK + GD + ++ G+ S    +  +P++ +  +       DLIKD+C++F NPP PCKD +
Sbjct:   59 DTVLLQVYYESFCPFCVQFFTGELKTVIETLGQYIDIRTYPYGNAKTIIDENGKYKIECQHGPAECYGNKLHACALDLL-----QNKTEALIFNSCLMTRRKNTRGSDDKAADACGTELNVDSN---KIKECAKGNKGDELLKYYGDESKKANFHYVPYILV--QGRVNDRGDLIKDICSVFVNPPPPCKDTE 241          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|910346567|ref|XP_013177195.1| (PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like [Papilio xuthus])

HSP 1 Score: 135.191 bits (339), Expect = 4.703e-36
Identity = 70/191 (36.65%), Postives = 108/191 (56.54%), Query Frame = 0
Query:    4 SKEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLG-EYSLLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPC 193
            S E V++ +FYE++ P C+ F       ++ KL +++ V+T P+G A     + G + F CQHG  ECYGNKLH C              +++ FNTC+M L+   +GS+D + D CG    +     A+IK CAKS  GD +F+F G E + + Y ++P+V +N  P  G  ++L+++VCA F  PP  C
Sbjct:   57 SNERVVIQVFYESLSPECKSFHKHILMPVVQKLNNNIRVMTYPFGNAQVLN-HQGHMEFKCQHGPEECYGNKLHACTLALMGNRT-----QALVFNTCMMSLKGHSHGSDDHSADLCGKTYKVDT---ASIKECAKSSTGDELFKFFGDESTKVNYKNVPYVLINGRPCKG--DNLMRNVCAAFSKPPAVC 236          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|768438819|ref|XP_011561012.1| (PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Plutella xylostella])

HSP 1 Score: 133.65 bits (335), Expect = 2.783e-35
Identity = 73/190 (38.42%), Postives = 103/190 (54.21%), Query Frame = 0
Query:    6 EIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYS-LLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCK 194
            E V + ++YE +CP CR+FD+     ++ +L D L + T PYG A T + ++G  TF CQHG  ECYGNKLH CA             +++  N C+MD  ++  GS+D A+D CG  M       A IK CA SD G ++ E  GE S  + Y  +P+V +N +       DL+K VC  F  PP  C+
Sbjct:   44 EKVAIKIYYECLCPDCRRFDSEQLVPVMRRLTDRLDIQTFPYGNAKTEE-HDGKPTFTCQHGPAECYGNKLHACALDLLRNHS-----QALLVNACMMDPSQAGRGSDDQALDVCGKAMGFD---TAPIKHCATSDRGTQLLEHYGEESGKVGYDYVPYVLINDQVLDPDCSDLLKVVCEAFVAPPRECR 224          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|930676559|gb|KPJ16699.1| (Gamma-interferon-inducible lysosomal thiol reductase [Papilio machaon])

HSP 1 Score: 139.813 bits (351), Expect = 3.867e-35
Identity = 73/186 (39.25%), Postives = 106/186 (56.99%), Query Frame = 0
Query:    8 VLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYS-LLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEP 192
            VLV ++YE++CP CR F T     ++ KLG ++++ T PYG A T    NG  T  CQHG  ECYGNKLH CA         + + +++ FN CLM    +  GS+D A D CG+++N+       IK CAKS+ GD + +  GE S    +  +P++ +      G  E+L+KD+C +F NPP P
Sbjct:   51 VLVQVYYESLCPACRLFFTDQLKPVVEKLGQYINIRTYPYGNAKTIIDENGDYTIKCQHGPPECYGNKLHACALNLL-----QNKTQALIFNACLMTRRPNSRGSDDKAADACGTELNLDSNT---IKECAKSNKGDELLKHYGEESKKANFNYVPYILIQGRVNDG--EELMKDICNVFTNPPPP 226          

HSP 2 Score: 131.339 bits (329), Expect = 4.814e-32
Identity = 69/191 (36.13%), Postives = 106/191 (55.50%), Query Frame = 0
Query:    4 SKEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLG-EYSLLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPC 193
            SKE V++ +FYE++ P C+ F       ++  L  ++ V+T P+G A       G   F CQHG  ECYGNKLH C              +++ FNTC+M L+   +GS+D + D CG    ++ +   +IK CAKS  GD +F+F G E + + Y ++P+V +N  P  G  ++L+++VCA F  PP  C
Sbjct:  451 SKERVVIQVFYESLSPECKNFHKHILMPVVQILNKNIRVMTYPFGNAQVVN-NQGHTEFKCQHGPEECYGNKLHACTLALMGNRT-----QALVFNTCMMSLKGGSHGSDDHSADVCGKTYKVNTE---SIKECAKSSTGDELFKFFGDESTKVNYKNVPYVLINGRPCKG--DNLMRNVCAAFSKPPAAC 630          

HSP 3 Score: 112.464 bits (280), Expect = 2.560e-25
Identity = 67/173 (38.73%), Postives = 98/173 (56.65%), Query Frame = 0
Query:    5 KEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYSLL-KYTSLPHVELNFEPWTGKHE 176
            +E VL+ L+YE +CP C QF T  F   I +LG++L V T PYG A T++  NG+  F CQHG  ECYGNKLH CA         + + +++ FN+CLM        S+D   D+CG + N+      +IK CAK D G  + ++ G+ S    Y+ +P++++N     GKH 
Sbjct:  257 QEKVLIQLYYECLCPFCTQFYTEVFIPTIRELGEYLDVRTYPYGNAWTSE-RNGSYVFDCQHGRAECYGNKLHACALDLL-----QNKTQALVFNSCLM-----VGNSDDSDADQCGKEQNVD---ADSIKECAKGDKGTLLLKYYGDESAKGHYSYVPYLKIN-----GKHR 410          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|913320123|ref|XP_013191163.1| (PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like [Amyelois transitella])

HSP 1 Score: 132.494 bits (332), Expect = 5.789e-35
Identity = 73/189 (38.62%), Postives = 112/189 (59.26%), Query Frame = 0
Query:    6 EIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLGEYS-LLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPC 193
            E V + L+YET+CP C Q ++T F  +++ L  +L++ T PYG A T +  NG++ F CQHG  ECYGNKLH C+  +           +++FN C+M+      GS+D AV +C  +MNI DK  + I  CA+   G ++ ++ GE S    +  +P+V +N   W  ++  L++DVCA FK+PPE C
Sbjct:   58 ETVDLQLYYETLCPYCIQLESTQFKNVVNTLSPYLNIKTYPYGNAQTIE-TNGSIEFKCQHGPKECYGNKLHACSLKHITNHT-----DALNFNICMMETNDKTRGSDDAAVLKCADEMNI-DK--SQILQCARGKEGGQLLKYYGEESHKANFNYVPYVLINGVEWL-QNGTLMQDVCAAFKDPPEVC 236          
BLAST of HiSeq13236 vs. genbank:protein
Match: gi|943945647|ref|XP_014356064.1| (PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like [Papilio machaon])

HSP 1 Score: 131.724 bits (330), Expect = 7.492e-35
Identity = 69/191 (36.13%), Postives = 106/191 (55.50%), Query Frame = 0
Query:    4 SKEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKAATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNTCLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFLG-EYSLLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPC 193
            SKE V++ +FYE++ P C+ F       ++  L  ++ V+T P+G A       G   F CQHG  ECYGNKLH C              +++ FNTC+M L+   +GS+D + D CG    ++ +   +IK CAKS  GD +F+F G E + + Y ++P+V +N  P  G  ++L+++VCA F  PP  C
Sbjct:   39 SKERVVIQVFYESLSPECKNFHKHILMPVVQILNKNIRVMTYPFGNAQVVN-NQGHTEFKCQHGPEECYGNKLHACTLALMGNRT-----QALVFNTCMMSLKGGSHGSDDHSADVCGKTYKVNTE---SIKECAKSSTGDELFKFFGDESTKVNYKNVPYVLINGRPCKG--DNLMRNVCAAFSKPPAAC 218          
The following BLAST results are available for this feature:
BLAST of HiSeq13236 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930652477|gb|KPI94816.1|6.753e-4139.15Gamma-interferon-inducible lysosomal thiol reducta... [more]
gi|910346569|ref|XP_013177197.1|2.722e-4038.62PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|943945889|ref|XP_014356162.1|7.082e-4039.68PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|909559582|ref|XP_013134852.1|7.182e-3837.70PREDICTED: gamma-interferon-inducible-lysosomal th... [more]
gi|909559510|ref|XP_013134813.1|1.492e-3737.31PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|910346567|ref|XP_013177195.1|4.703e-3636.65PREDICTED: gamma-interferon-inducible-lysosomal th... [more]
gi|768438819|ref|XP_011561012.1|2.783e-3538.42PREDICTED: gamma-interferon-inducible lysosomal th... [more]
gi|930676559|gb|KPJ16699.1|3.867e-3539.25Gamma-interferon-inducible lysosomal thiol reducta... [more]
gi|913320123|ref|XP_013191163.1|5.789e-3538.62PREDICTED: gamma-interferon-inducible-lysosomal th... [more]
gi|943945647|ref|XP_014356064.1|7.492e-3536.13PREDICTED: gamma-interferon-inducible-lysosomal th... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPFAMPF03227GILTcoord: 8..123
e-value: 2.0E-16
score: 59.7
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPANTHERPTHR13234GAMMA-INTERFERON INDUCIBLE LYSOSOMAL THIOL REDUCTASE (GILT)coord: 6..196
IPR012336Thioredoxin-like foldGENE3D3.40.30.10coord: 9..49
e-value: 4.6E-4
score: 19.3
IPR012336Thioredoxin-like foldSUPERFAMILY52833Thioredoxin-likecoord: 8..131

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13236HiSeq13236Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13236_p ID=HiSeq13236_p|Name=HiSeq13236|organism=Ostrinia scapulalis|type=polypeptide|length=197bp
MXVSKEIVLVDLFYETMCPGCRQFDTTYFSELIHKLGDHLSVITIPYGKA
ATTKYYNGTLTFWCQHGELECYGNKLHGCAHYYFAQEEKEEEYKSIHFNT
CLMDLERSENGSNDDAVDECGSKMNISDKVLANIKSCAKSDLGDRIFEFL
GEYSLLKYTSLPHVELNFEPWTGKHEDLIKDVCALFKNPPEPCKDVK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR012336Thioredoxin-like_fold
IPR004911Interferon-induced_GILT