HiSeq13241_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13241
Unique NameHiSeq13241_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length337
Homology
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|512894099|ref|XP_004923349.1| (PREDICTED: protein SEC13 homolog [Bombyx mori])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 293/313 (93.61%), Postives = 308/313 (98.40%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MITVLNTIDTGHEDMIHDAELDYYGL+LATCSSDNSVKIYDIK+GTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISII    D+GNWDVKKITGAHAIGVNS+SWCPA+SADLNLDPL+NKDAPKR+V+GGCDNLIKIWREQGDQW+EENRLE+H+DWVRDVAWAPSLGLQRSMIASCSQDKRVVIW+SDDNVSWTPTILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+ES DGQWLCISEVAKGLGQTPN+ERSTL
Sbjct:    1 MITVLNTIDTGHEDMIHDAELDYYGLKLATCSSDNSVKIYDIKNGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIQYSQDTGNWDVKKITGAHAIGVNSISWCPALSADLNLDPLTNKDAPKRLVTGGCDNLIKIWREQGDQWVEENRLELHIDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWSSDDNVSWTPTILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWRESTDGQWLCISEVAKGLGQTPNDERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|1073546789|gb|JAT90506.1| (hypothetical protein g.11690 [Pectinophora gossypiella])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 296/313 (94.57%), Postives = 306/313 (97.76%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIT   D GNWDVKKI GAHAIGVNS+SWCPAISADLNLDPLSNK+APKRIVSGGCDNLIKIWREQGDQW+EENRLEMHMDWVRDVAWAPSLGLQRSM+ASCSQDKRVVIWTSDDN+SWTPTILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+E  DGQWLCISEVAKGLGQTP++ERSTL
Sbjct:    1 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIT-YQDGGNWDVKKIPGAHAIGVNSISWCPAISADLNLDPLSNKEAPKRIVSGGCDNLIKIWREQGDQWVEENRLEMHMDWVRDVAWAPSLGLQRSMMASCSQDKRVVIWTSDDNISWTPTILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWREGTDGQWLCISEVAKGLGQTPSDERSTL 312          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|914567167|gb|KOB71518.1| (Protein transport protein sec13 [Operophtera brumata])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 295/313 (94.25%), Postives = 304/313 (97.12%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQ+AWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPA+YGLILACCSSDGSISIIT V ++GNWDVKKI G HAIGVNSVSWCPAISADLNLDPLSNK+APKRIV+GGCDNLIKIWREQGDQW+EENRLEMHMDWVRDVAWAPS GLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLWKE  D QWLCISEVAKGLG TPN+ERSTL
Sbjct:    1 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQIAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPADYGLILACCSSDGSISIITYVQETGNWDVKKIPGGHAIGVNSVSWCPAISADLNLDPLSNKEAPKRIVTGGCDNLIKIWREQGDQWLEENRLEMHMDWVRDVAWAPSFGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWKEGSDNQWLCISEVAKGLGLTPNDERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|357630898|gb|EHJ78717.1| (putative protein transport protein sec13 [Danaus plexippus])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 291/313 (92.97%), Postives = 304/313 (97.12%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEWTKLYEY+GHESSVNSVAWAP EYGLILACCSSDGSIS IT   D GNWDVKKI GAHAIGVNS+SWCPAISADL+LDPL+NKDAPKRIVSGGCDNLIKIW+EQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIW+SDDNVSW+PTILNTFDDV+WS+SWSLTGNILAVSGGDNKVSLW+E+ DGQWLCISEVAKGLGQ PNEERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWTKLYEYSGHESSVNSVAWAPEEYGLILACCSSDGSISTITYNQDGGNWDVKKIPGAHAIGVNSISWCPAISADLHLDPLTNKDAPKRIVSGGCDNLIKIWKEQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWSSDDNVSWSPTILNTFDDVIWSVSWSLTGNILAVSGGDNKVSLWRENADGQWLCISEVAKGLGQAPNEERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|910335259|ref|XP_013171088.1| (PREDICTED: protein SEC13 homolog [Papilio xuthus] >gi|930649857|gb|KPI92203.1| Protein SEC13-like [Papilio xuthus])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 291/313 (92.97%), Postives = 304/313 (97.12%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDN+VKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIT   D  NW+VKKI GAHAIGVNS+SWCPAISADL+LDPL+N+DAPKRIVSGGCDNLIKIW+EQGDQW+EENRLEMHMDWVRDVAWAPSLGLQ SMIASCSQDKRVVIWTSDDNVSW+P ILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLW+E+ DGQWLCISEVAKGLGQTPNEERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNTVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITYNQDGANWEVKKIPGAHAIGVNSISWCPAISADLSLDPLTNRDAPKRIVSGGCDNLIKIWKEQGDQWVEENRLEMHMDWVRDVAWAPSLGLQHSMIASCSQDKRVVIWTSDDNVSWSPVILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWRENADGQWLCISEVAKGLGQTPNEERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|943954131|ref|XP_014359987.1| (PREDICTED: protein SEC13 homolog [Papilio machaon] >gi|930673391|gb|KPJ13918.1| Protein SEC13-like [Papilio machaon])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 290/313 (92.65%), Postives = 304/313 (97.12%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDN+VK+YDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIT   D  NW+VKKI GAHAIGVNS+SWCPAISADL+LDPL+N+DAPKRIVSGGCDNLIKIW+EQGDQW+EENRLEMHMDWVRDVAWAPSLGLQ SMIASCSQDKRVVIWTSDDNVSWTP ILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+E+ DGQWLCISEVAKGLGQTPNEERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNTVKVYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITYNQDGANWEVKKIPGAHAIGVNSISWCPAISADLSLDPLTNRDAPKRIVSGGCDNLIKIWKEQGDQWVEENRLEMHMDWVRDVAWAPSLGLQHSMIASCSQDKRVVIWTSDDNVSWTPVILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWRENGDGQWLCISEVAKGLGQTPNEERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|909560760|ref|XP_013135481.1| (PREDICTED: protein SEC13 homolog [Papilio polytes])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 288/313 (92.01%), Postives = 304/313 (97.12%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDN+VKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKE+GEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIIT   D  NW+VKKI GAHAIGVNS+SWCPAISADL+LDPL+N++APKRIVSGGCDNLIKIW+EQGDQW+EENRLEMHMDWVRDVAWAPSLGLQ SMIASCSQDKRVVIW+SDDNVSWTP ILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+E+ DGQWLCISEVAKGLGQTPNEERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNTVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKEAGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITYNQDGANWEVKKIPGAHAIGVNSISWCPAISADLSLDPLTNREAPKRIVSGGCDNLIKIWKEQGDQWVEENRLEMHMDWVRDVAWAPSLGLQHSMIASCSQDKRVVIWSSDDNVSWTPVILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWRENADGQWLCISEVAKGLGQTPNEERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|913322002|ref|XP_013192191.1| (PREDICTED: protein SEC13 homolog [Amyelois transitella])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 298/313 (95.21%), Postives = 307/313 (98.08%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIK+GTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPA+YGLILACCSSDGSISII+   DSGNWDVKKI GAHAIGVNSVSWCPAISADLNLDPLSNK+APKRIVSGGCDNLIKIWREQGDQW+EENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILN FDDVVWS+SWSLTGNILAVSGGDNKVSLWKES DGQW+CISEVAKGLGQTPN+ERSTL
Sbjct:    1 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKNGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPADYGLILACCSSDGSISIISYAQDSGNWDVKKIPGAHAIGVNSVSWCPAISADLNLDPLSNKEAPKRIVSGGCDNLIKIWREQGDQWVEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNVFDDVVWSVSWSLTGNILAVSGGDNKVSLWKESSDGQWICISEVAKGLGQTPNDERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|509181715|gb|JAA88978.1| (protein transport protein sec13 [Pararge aegeria])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 281/313 (89.78%), Postives = 300/313 (95.85%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPK+GNLLASCSYDRKVIIWKESGEW+KLYEYTGHESSVN+VAWAPAEYGL+LACCSSDGSIS I+   D   WDVKKI GAHAIGVNSVSWCPAISA+L+LDPL+NK+APKRIVSGGCDNLIKIW+EQGDQWIEE RL+MHMDW+RDVAWAPS GLQRSMIASCSQDKRVVIW+SDDN+SWTPTILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+E+ DGQWLCISEVAKGLGQ  N+ERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKFGNLLASCSYDRKVIIWKESGEWSKLYEYTGHESSVNAVAWAPAEYGLVLACCSSDGSISTISYNQDGATWDVKKIPGAHAIGVNSVSWCPAISAELSLDPLTNKEAPKRIVSGGCDNLIKIWKEQGDQWIEEKRLDMHMDWIRDVAWAPSFGLQRSMIASCSQDKRVVIWSSDDNISWTPTILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWRENADGQWLCISEVAKGLGQPTNDERSTL 313          
BLAST of HiSeq13241 vs. genbank:protein
Match: gi|694452807|ref|XP_009351269.1| (PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri] >gi|768439612|ref|XP_011561446.1| PREDICTED: protein SEC13 homolog [Plutella xylostella])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 291/313 (92.97%), Postives = 302/313 (96.49%), Query Frame = 0
Query:   25 MITVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDAPKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRSMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSGGDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL 337
            MI+VLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTL ADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKE+GEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISII+   D GNW+ KKITGAHAIG NS+SWCPAISADL+LDPLSNKDAPKR+VSGGCDNLIKIWREQGDQW+EENRLEMHMDWVRDVAWAPSLGLQ SMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWS+SWSLTGNILAVSGGDNKVSLW+E  DGQW CISEVAKGLGQTP+EERSTL
Sbjct:    1 MISVLNTIDTGHEDMIHDAELDYYGLRLATCSSDNSVKIYDIKSGTQTLVADLKGHFGPVWQVAWAHPKYGNLLASCSYDRKVIIWKEAGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDGSISIISYNQDGGNWESKKITGAHAIGCNSISWCPAISADLSLDPLSNKDAPKRLVSGGCDNLIKIWREQGDQWMEENRLEMHMDWVRDVAWAPSLGLQESMIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSVSWSLTGNILAVSGGDNKVSLWREGTDGQWSCISEVAKGLGQTPSEERSTL 313          
The following BLAST results are available for this feature:
BLAST of HiSeq13241 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|512894099|ref|XP_004923349.1|0.000e+093.61PREDICTED: protein SEC13 homolog [Bombyx mori][more]
gi|1073546789|gb|JAT90506.1|0.000e+094.57hypothetical protein g.11690 [Pectinophora gossypi... [more]
gi|914567167|gb|KOB71518.1|0.000e+094.25Protein transport protein sec13 [Operophtera bruma... [more]
gi|357630898|gb|EHJ78717.1|0.000e+092.97putative protein transport protein sec13 [Danaus p... [more]
gi|910335259|ref|XP_013171088.1|0.000e+092.97PREDICTED: protein SEC13 homolog [Papilio xuthus] ... [more]
gi|943954131|ref|XP_014359987.1|0.000e+092.65PREDICTED: protein SEC13 homolog [Papilio machaon]... [more]
gi|909560760|ref|XP_013135481.1|0.000e+092.01PREDICTED: protein SEC13 homolog [Papilio polytes][more]
gi|913322002|ref|XP_013192191.1|0.000e+095.21PREDICTED: protein SEC13 homolog [Amyelois transit... [more]
gi|509181715|gb|JAA88978.1|0.000e+089.78protein transport protein sec13 [Pararge aegeria][more]
gi|694452807|ref|XP_009351269.1|0.000e+092.97PREDICTED: protein SEC13 homolog [Pyrus x bretschn... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40coord: 115..156
e-value: 1.4E-5
score: 34.6
coord: 163..217
e-value: 0.027
score: 23.6
coord: 222..265
e-value: 0.026
score: 23.7
coord: 70..111
e-value: 1.2E-6
score: 38.0
coord: 273..309
e-value: 0.0017
score: 27.6
coord: 25..65
e-value: 8.5E-4
score: 28.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 229..264
e-value: 6.8E-7
score: 28.8
coord: 276..309
e-value: 2.0E-4
score: 20.9
coord: 164..216
e-value: 1.8E-8
score: 33.7
coord: 31..65
e-value: 0.001
score: 18.7
coord: 116..154
e-value: 4.7E-9
score: 35.6
coord: 76..111
e-value: 5.7E-9
score: 35.4
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 33..74
score: 9.94
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 229..264
score: 9.005
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 277..309
score: 8.904
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 77..111
score: 9.472
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 34..315
e-value: 3.1E-56
score: 189.8
NoneNo IPR availablePANTHERPTHR11024PROTEIN TRANSPORT PROTEIN SEC13-RELATEDcoord: 21..325
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 33..309
score: 26.683
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 38..317

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13241HiSeq13241Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13241_p ID=HiSeq13241_p|Name=HiSeq13241|organism=Ostrinia scapulalis|type=polypeptide|length=337bp
IRVVWLRVVCSCVRFELCGCTFSKMITVLNTIDTGHEDMIHDAELDYYGL
RLATCSSDNSVKIYDIKSGTQTLAADLKGHFGPVWQVAWAHPKYGNLLAS
CSYDRKVIIWKESGEWTKLYEYTGHESSVNSVAWAPAEYGLILACCSSDG
SISIITNVLDSGNWDVKKITGAHAIGVNSVSWCPAISADLNLDPLSNKDA
PKRIVSGGCDNLIKIWREQGDQWIEENRLEMHMDWVRDVAWAPSLGLQRS
MIASCSQDKRVVIWTSDDNVSWTPTILNTFDDVVWSLSWSLTGNILAVSG
GDNKVSLWKESPDGQWLCISEVAKGLGQTPNEERSTL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR017986WD40_repeat_dom
IPR015943WD40/YVTN_repeat-like_dom
IPR001680WD40_repeat