HiSeq13242_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13242
Unique NameHiSeq13242_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length33
Homology
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|909565588|ref|XP_013138115.1| (PREDICTED: uncharacterized protein LOC106103027 [Papilio polytes])

HSP 1 Score: 67.0106 bits (162), Expect = 7.187e-13
Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0
Query:    1 MDREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            +DREVDDEN QILRQMGNFRRRK GN +KNKHV
Sbjct:  143 IDREVDDENVQILRQMGNFRRRKAGNPIKNKHV 175          
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|910349848|ref|XP_013178967.1| (PREDICTED: uncharacterized protein LOC106126049 [Papilio xuthus])

HSP 1 Score: 65.855 bits (159), Expect = 1.674e-12
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
Query:    2 DREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            DREVDDEN QILRQMGNFRRRK GN +KNKHV
Sbjct:  144 DREVDDENLQILRQMGNFRRRKAGNPIKNKHV 175          
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|943958012|ref|XP_014361736.1| (PREDICTED: uncharacterized protein LOC106713444 [Papilio machaon] >gi|930671936|gb|KPJ12605.1| hypothetical protein RR48_02238 [Papilio machaon])

HSP 1 Score: 65.0846 bits (157), Expect = 3.539e-12
Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 0
Query:    1 MDREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            +DREVD+EN QILRQMGNFRRRK GN +KNKHV
Sbjct:  143 IDREVDEENVQILRQMGNFRRRKAGNPIKNKHV 175          
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|930658224|gb|KPJ00430.1| (hypothetical protein RR46_07020 [Papilio xuthus])

HSP 1 Score: 61.2326 bits (147), Expect = 2.101e-11
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
Query:    2 DREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            DREVDDEN QILRQMGNFRRRK GN +KNKHV
Sbjct:   63 DREVDDENLQILRQMGNFRRRKAGNPIKNKHV 94          
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|357630850|gb|EHJ78698.1| (Erg28-domain containing protein [Danaus plexippus])

HSP 1 Score: 61.2326 bits (147), Expect = 1.139e-10
Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = 0
Query:    1 MDREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            MDRE+DDEN QILRQMG FRRRKP  T+KNKHV
Sbjct:  142 MDRELDDENVQILRQMGTFRRRKP--TIKNKHV 172          
BLAST of HiSeq13242 vs. genbank:protein
Match: gi|114052995|ref|NP_001040499.1| (Erg28-domain containing protein [Bombyx mori] >gi|95103144|gb|ABF51513.1| GA14428-PA [Bombyx mori])

HSP 1 Score: 58.9214 bits (141), Expect = 7.579e-10
Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = 0
Query:    1 MDREVDDENTQILRQMGNFRRRKPGNTVKNKHV 33
            MDREV+DEN QILRQ GNFRRRK GNT KNKHV
Sbjct:  143 MDREVEDENVQILRQRGNFRRRKTGNT-KNKHV 174          
The following BLAST results are available for this feature:
BLAST of HiSeq13242 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 6
Match NameE-valueIdentityDescription
gi|909565588|ref|XP_013138115.1|7.187e-1384.85PREDICTED: uncharacterized protein LOC106103027 [P... [more]
gi|910349848|ref|XP_013178967.1|1.674e-1287.50PREDICTED: uncharacterized protein LOC106126049 [P... [more]
gi|943958012|ref|XP_014361736.1|3.539e-1281.82PREDICTED: uncharacterized protein LOC106713444 [P... [more]
gi|930658224|gb|KPJ00430.1|2.101e-1187.50hypothetical protein RR46_07020 [Papilio xuthus][more]
gi|357630850|gb|EHJ78698.1|1.139e-1081.82Erg28-domain containing protein [Danaus plexippus][more]
gi|114052995|ref|NP_001040499.1|7.579e-1084.85Erg28-domain containing protein [Bombyx mori] >gi|... [more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13242HiSeq13242Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13242_p ID=HiSeq13242_p|Name=HiSeq13242|organism=Ostrinia scapulalis|type=polypeptide|length=33bp
MDREVDDENTQILRQMGNFRRRKPGNTVKNKHV
back to top