HiSeq13245_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13245
Unique NameHiSeq13245_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length237
Homology
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|913319137|ref|XP_013190630.1| (PREDICTED: uncharacterized protein LOC106135015 [Amyelois transitella])

HSP 1 Score: 288.5 bits (737), Expect = 1.211e-95
Identity = 137/240 (57.08%), Postives = 169/240 (70.42%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKS---EGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVNDTDSYEDY 237
            MW  K+LFV  LC     G+ +D+ P LYYY +EESER LP C ARQAC  LL RYWR  AL+RLC CR R RC A A P+R + +NN A  QFC   TDWP+C   +T L VES YDRM+PDE+EE HH+NIQL PP I   C+C    YW LK  +   E T  YQC  LP+C+T EFCGNV  +L +LYQSCLCP+HHICVH+GGV ++ I+E+LY G+GW+AYC++V+D  SYE+Y
Sbjct:    2 MWVFKILFVSTLCVYARAGNENDD-PVLYYYALEESERSLPLCSARQACSALLLRYWRAPALVRLCGCRRRERCDARAEPDRLIEINNRAYFQFCKPVTDWPECSLNDTPLTVESLYDRMDPDEIEESHHKNIQLAPPKIIFKCRCPNSNYWGLKLSADDNEITEQYQCTSLPLCKTDEFCGNVNLNLNSLYQSCLCPKHHICVHDGGVTHNIITELLYRGKGWRAYCRRVDDYYSYEEY 240          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|943975499|ref|XP_014368941.1| (PREDICTED: uncharacterized protein LOC106719183 [Papilio machaon] >gi|930666084|gb|KPJ07207.1| hypothetical protein RR48_07623 [Papilio machaon])

HSP 1 Score: 267.7 bits (683), Expect = 1.908e-87
Identity = 122/228 (53.51%), Postives = 156/228 (68.42%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKV 228
            MWT  +   + LC   +  S   +EP LYYYG+EESERGL ACGARQAC  LL ++WR  ALLRLCRC  R RC   A  +R + LNN A  QFC+  T WP+C   +T L+V++ YDRMNPDE+E MHH+N+ L PPN+T+NC C  P YW+  +       YQCG +P+C++G+FCGNV  +L ALYQ CLCPR H+C HNGGV    ISE+LY G+GW+A+C  +
Sbjct:    1 MWTFHIFLFITLCT--LTLSDDSDEPILYYYGLEESERGLGACGARQACSALLLQHWRAPALLRLCRCPRRQRCDTRASNDRLVELNNRAYFQFCTPVTKWPECTLSDTPLIVDTQYDRMNPDEIETMHHQNVALVPPNVTLNCLCRYPNYWRWNSTQGTISKYQCGSMPLCKSGDFCGNVNYELNALYQWCLCPRQHMCAHNGGVTRLYISELLYRGRGWRAHCHPL 226          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|768434704|ref|XP_011558769.1| (PREDICTED: uncharacterized protein LOC105389369 [Plutella xylostella])

HSP 1 Score: 264.233 bits (674), Expect = 5.068e-86
Identity = 126/232 (54.31%), Postives = 162/232 (69.83%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPE-RTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRS--YQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVN 229
            MWT+K   +L+ C     G   DE P  YYYG+EESERGLP C  RQAC  LLQRYWR  AL+R CRC  R RC A +  + RT+ LNN ++ +FC  TT+WP C  G+ +L+  + + R++PDELEE+HH+N+ LTP  IT NC+C QP YWK  + S   ++  + C  LP CRTGE CG V +DL++LYQSCLCPRHHICVHNGGV Y ++SE+LY G G +AYCQ+V+
Sbjct:    1 MWTLKT--ILIFCVIISVGCKIDE-PTTYYYGLEESERGLPGCAPRQACSALLQRYWRAPALVRFCRCGRRLRCPASSVQDHRTVELNNRSQFKFCQPTTNWPMCSPGQIALISNTTFARLDPDELEELHHQNVHLTPAKITFNCRCRQPNYWKFHSTSSDLKAQYFTCQALPNCRTGEACGTVRADLHSLYQSCLCPRHHICVHNGGVTYINMSELLYRGSGRQAYCQRVS 229          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|913318846|ref|XP_013190471.1| (PREDICTED: uncharacterized protein LOC106134876 [Amyelois transitella])

HSP 1 Score: 261.536 bits (667), Expect = 2.626e-85
Identity = 122/209 (58.37%), Postives = 150/209 (71.77%), Query Frame = 0
Query:   32 GIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKS---EGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVNDTDSYEDY 237
             +EESER LP C ARQAC  LL RYWR  AL+RLC CR R RC A A P+R + +NN A  QFC   TDWP+C   +T L VES YDRM+PDE+EE HH+NIQL PP I   C+C    YW LK  +   E T  YQC  LP+C+T EFCGNV  +L +LYQSCLCP+HHICVH+GGV ++ I+E+LY G+GW+AYC++V+D  SYE+Y
Sbjct:    7 SLEESERSLPLCSARQACSALLLRYWRAPALVRLCGCRRRERCDARAEPDRLIEINNRAYFQFCKPVTDWPECSLNDTPLTVESLYDRMDPDEIEESHHKNIQLAPPKIIFKCRCPNSNYWGLKLSADDNEITEQYQCTSLPLCKTDEFCGNVNLNLNSLYQSCLCPKHHICVHDGGVTHNIITELLYRGKGWRAYCRRVDDYYSYEEY 215          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|768418203|ref|XP_011549778.1| (PREDICTED: uncharacterized protein LOC105381687 [Plutella xylostella])

HSP 1 Score: 261.536 bits (667), Expect = 6.602e-85
Identity = 125/232 (53.88%), Postives = 163/232 (70.26%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPE-RTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRS--YQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVN 229
            MWT+K   +L+LC     G   DE P  YYYG+EESERGLP C  RQAC  LLQRYWR  AL+R C C  R RC A +  + RT+ LNN ++ +FC  TT+WP C  G+ +L+  + + R++PDELEE+HH+N+ LTP  IT NC+C QP YWK  + S   ++  + C  LP CRTG+ CG V +DL++LYQSCLCPRHHICVHNGGV Y ++SE+LY G+G +AYCQ+V+
Sbjct:    1 MWTLKT--ILILCVIISVGCKIDE-PTTYYYGLEESERGLPGCAPRQACSALLQRYWRAPALVRFCGCGRRLRCPASSVQDHRTVELNNRSQFKFCQPTTNWPMCSPGQIALISNTTFARLDPDELEELHHQNVHLTPAKITFNCRCRQPNYWKFHSTSSDLKAQYFTCQALPNCRTGDACGTVRADLHSLYQSCLCPRHHICVHNGGVTYINMSELLYRGRGRQAYCQRVS 229          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|768410376|ref|XP_011557816.1| (PREDICTED: uncharacterized protein LOC105388573 [Plutella xylostella])

HSP 1 Score: 244.973 bits (624), Expect = 2.307e-78
Identity = 128/232 (55.17%), Postives = 164/232 (70.69%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPE-RTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRS--YQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVN 229
            MWT+K   +L+LC     G   DE P  YYYG+EESERGLP C  RQAC  LLQRYWR  AL+RLCRC  R RC A    + RT+ LNN ++ +FC  TT+WP C  G+ +L+  + + R++PDELEE+HH+N+ LTP  IT NC+C QP YWK  + S   ++  + C  LP CRTGE CG V +DL++LYQSCLCPRHHICVHNGGV Y ++SE+LY G+G +AYCQ+V+
Sbjct:    1 MWTLKT--ILILCVIISVGCKIDE-PTTYYYGLEESERGLPGCAPRQACSALLQRYWRAPALVRLCRCGRRLRCPASGVLDHRTVELNNRSQFKFCQPTTNWPMCSPGQIALISNTTFARLDPDELEELHHQNVHLTPAKITFNCRCRQPNYWKFHSTSSDLKAQYFTCQALPNCRTGEACGTVRADLHSLYQSCLCPRHHICVHNGGVTYINMSELLYRGRGRQAYCQRVS 229          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|512928167|ref|XP_004931516.1| (PREDICTED: uncharacterized protein LOC101742806 [Bombyx mori])

HSP 1 Score: 244.588 bits (623), Expect = 2.490e-78
Identity = 125/237 (52.74%), Postives = 161/237 (67.93%), Query Frame = 0
Query:    1 MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKVNDTDSYEDY 237
            MW   +L  L L N++I   +  +E  LYYYG+EESER LP C  RQAC  L+ RYWR  AL+RLCRC  R RC +PA   R +++NN A LQFC   T WPQC     +L V + ++RMNPDELEE+HHRNI L PP I  +C+C +P YWKL++  +    +QC  LP+C T E CG+V  +LY LYQSCLCP+ HIC+H GGV Y  I+E+LY G+GWKA+C ++ +  SYEDY
Sbjct:    1 MWFYVIL--LTLLNSYICIENETDEVILYYYGLEESERSLPFCEPRQACSALIPRYWRASALVRLCRCARRLRCDSPAKHNRRIAINNRAYLQFCQPVTSWPQCSNNAKALTVMTTHERMNPDELEELHHRNIHLEPPKIIFSCRCPEPNYWKLQSNYDNEYIFQCSSLPLCMTDEQCGHVNLNLYTLYQSCLCPKGHICIHEGGVAYTQITELLYIGKGWKAHCTQIANDSSYEDY 235          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|910337251|ref|XP_013172189.1| (PREDICTED: DNA excision repair protein haywire-like isoform X2 [Papilio xuthus])

HSP 1 Score: 253.832 bits (647), Expect = 2.000e-74
Identity = 111/195 (56.92%), Postives = 138/195 (70.77%), Query Frame = 0
Query:   34 EESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKV 228
            EESERGL ACG RQAC  LL R+WR  ALLRLCRC  R RC   AP +R + LNN A  QFC+  T WP+C   +T L+V++ YDRMNPDE+E MHH+N+ L PPN+T+NC C  P YW+  +       YQCG +P+C++G+FCGNV  +L ALYQ CLCPR H+C H GGV    ISE+LY G+GW+AYCQ +
Sbjct:  874 EESERGLGACGVRQACSALLLRHWRAPALLRLCRCPRRQRCDTRAPSDRLVELNNRAYFQFCTPVTKWPECTLSDTPLIVDTQYDRMNPDEIEAMHHQNVALVPPNVTLNCLCRYPNYWRWNSTQGSISKYQCGSMPLCKSGDFCGNVNYELNALYQWCLCPRQHMCAHGGGVTRLYISELLYRGRGWRAYCQPI 1068          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|930655007|gb|KPI97339.1| (DNA excision repair protein haywire [Papilio xuthus])

HSP 1 Score: 253.447 bits (646), Expect = 2.125e-74
Identity = 111/195 (56.92%), Postives = 138/195 (70.77%), Query Frame = 0
Query:   34 EESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKV 228
            EESERGL ACG RQAC  LL R+WR  ALLRLCRC  R RC   AP +R + LNN A  QFC+  T WP+C   +T L+V++ YDRMNPDE+E MHH+N+ L PPN+T+NC C  P YW+  +       YQCG +P+C++G+FCGNV  +L ALYQ CLCPR H+C H GGV    ISE+LY G+GW+AYCQ +
Sbjct:  874 EESERGLGACGVRQACSALLLRHWRAPALLRLCRCPRRQRCDTRAPSDRLVELNNRAYFQFCTPVTKWPECTLSDTPLIVDTQYDRMNPDEIEAMHHQNVALVPPNVTLNCLCRYPNYWRWNSTQGSISKYQCGSMPLCKSGDFCGNVNYELNALYQWCLCPRQHMCAHGGGVTRLYISELLYRGRGWRAYCQPI 1068          
BLAST of HiSeq13245 vs. genbank:protein
Match: gi|914567866|gb|KOB71987.1| (Haywire, isoform A [Operophtera brumata])

HSP 1 Score: 235.343 bits (599), Expect = 6.815e-73
Identity = 117/205 (57.07%), Postives = 139/205 (67.80%), Query Frame = 0
Query:   35 ESERGLPACGARQACGTLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTDWPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPYYWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHICVHNGGVVYHDISEILYEGQGWKAYCQKV-NDTD-SYEDY 237
            E+ER LPAC  RQAC  ++QRYWRP AL+R  R  +R +    A   RT        L FC  TTDWP C   E  L V + Y+RMNPDELE  HH  I+LTPP IT+ C+C  P YWKL +     R Y+C  LP+CRTGEFCGNV  DL ALYQSC+CP+HHICVHNGGV    ISE+LY+G+GWKAYCQ++  D+D SYEDY
Sbjct:  171 ENERSLPACEERQACSAMVQRYWRPAALVRRHRPTDRTQQPRSATGNRTC-------LIFCQPTTDWPACSIDENPLNVTTSYERMNPDELEMQHHEEIELTPPKITLKCKCRNPNYWKLNSTEGNVRIYRCASLPLCRTGEFCGNVNYDLNALYQSCMCPKHHICVHNGGVTRLLISELLYKGRGWKAYCQRIGTDSDYSYEDY 368          
The following BLAST results are available for this feature:
BLAST of HiSeq13245 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913319137|ref|XP_013190630.1|1.211e-9557.08PREDICTED: uncharacterized protein LOC106135015 [A... [more]
gi|943975499|ref|XP_014368941.1|1.908e-8753.51PREDICTED: uncharacterized protein LOC106719183 [P... [more]
gi|768434704|ref|XP_011558769.1|5.068e-8654.31PREDICTED: uncharacterized protein LOC105389369 [P... [more]
gi|913318846|ref|XP_013190471.1|2.626e-8558.37PREDICTED: uncharacterized protein LOC106134876 [A... [more]
gi|768418203|ref|XP_011549778.1|6.602e-8553.88PREDICTED: uncharacterized protein LOC105381687 [P... [more]
gi|768410376|ref|XP_011557816.1|2.307e-7855.17PREDICTED: uncharacterized protein LOC105388573 [P... [more]
gi|512928167|ref|XP_004931516.1|2.490e-7852.74PREDICTED: uncharacterized protein LOC101742806 [B... [more]
gi|910337251|ref|XP_013172189.1|2.000e-7456.92PREDICTED: DNA excision repair protein haywire-lik... [more]
gi|930655007|gb|KPI97339.1|2.125e-7456.92DNA excision repair protein haywire [Papilio xuthu... [more]
gi|914567866|gb|KOB71987.1|6.815e-7357.07Haywire, isoform A [Operophtera brumata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0009987 cellular process
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 6..13
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 14..22
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..5
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 23..237
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..22
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.732

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13245HiSeq13245Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13245_p ID=HiSeq13245_p|Name=HiSeq13245|organism=Ostrinia scapulalis|type=polypeptide|length=237bp
MWTIKVLFVLVLCNNHIYGSSSDEEPELYYYGIEESERGLPACGARQACG
TLLQRYWRPRALLRLCRCRNRARCLAPAPPERTMSLNNHAELQFCSSTTD
WPQCGFGETSLVVESDYDRMNPDELEEMHHRNIQLTPPNITVNCQCLQPY
YWKLKAKSEGTRSYQCGFLPVCRTGEFCGNVTSDLYALYQSCLCPRHHIC
VHNGGVVYHDISEILYEGQGWKAYCQKVNDTDSYEDY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0009987cellular process