HiSeq13250_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13250
Unique NameHiSeq13250_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length308
Homology
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|1181738908|gb|ARI71313.1| (juvenile hormone acid methyltransferase [Chilo suppressalis])

HSP 1 Score: 421.394 bits (1082), Expect = 2.218e-146
Identity = 194/264 (73.48%), Postives = 227/264 (85.98%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPASIRTNYKL 301
            MNNAELY+GNN LQKRDA+DCLEEFA+K+ WKRSG+RIIDIGCGDGSVTV LL+E++P+NFE LLGCD+SEKMVAFAN+HHK+ERT FTVLDI  +LP++LR+ F+H FS YT HWIKDQE AF N+FDLL  GG+CLL+ LGHNPVFDVYRILA+SNK   WL GV+RFISPYH+SQ PE+EI K+M KIGF DI V CQEK FIY+SPEAVKKAVQAVNPF MPK+VFDDFM+DY++V+RDM LIDE NN    + R+ Y L
Sbjct:    1 MNNAELYEGNNNLQKRDALDCLEEFADKMMWKRSGDRIIDIGCGDGSVTVDLLKEFIPENFELLLGCDVSEKMVAFANVHHKNERTSFTVLDIAGRLPEELRSNFNHAFSSYTFHWIKDQEAAFNNMFDLLVEGGQCLLTLLGHNPVFDVYRILAESNKCGCWLHGVERFISPYHDSQYPEQEIRKLMKKIGFTDIVVTCQEKSFIYDSPEAVKKAVQAVNPFSMPKEVFDDFMIDYLNVVRDMNLIDEVNNTNLRAGRSIYSL 264          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|910314749|ref|XP_013181602.1| (PREDICTED: juvenile hormone acid O-methyltransferase [Papilio xuthus] >gi|910314751|ref|XP_013181603.1| PREDICTED: juvenile hormone acid O-methyltransferase [Papilio xuthus] >gi|910314753|ref|XP_013181604.1| PREDICTED: juvenile hormone acid O-methyltransferase [Papilio xuthus] >gi|930650406|gb|KPI92751.1| Putative methyltransferase 235L [Papilio xuthus])

HSP 1 Score: 369.007 bits (946), Expect = 1.232e-125
Identity = 170/271 (62.73%), Postives = 214/271 (78.97%), Query Frame = 0
Query:   39 NNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPA-SIRTNYKLIVVYGSK 308
            ++AELY+ +NTLQKRDA++CLEE+A KI+W+   +RIIDIGCGDGSVT  +LR Y+P+N+ +L+GCDIS+ MV  AN HH + R  F V+DIE +LP+DLR  FDH FSFYTLHWIK QE AF NIFDLL  GG+CLL FLGH PVFDVYR+LA+S +W  WL  VDRF+SPYH++QEPEK+I  MM +IGF D+ VK +E+ FIY+S EAVKKAV AVNPF +P+D+ +DFM DY+ V+RDM+LID  NNN    S+R NY LI+ +G K
Sbjct:    3 DDAELYKKSNTLQKRDAVECLEEYAIKIKWRNYNDRIIDIGCGDGSVTSNILRRYIPNNYGRLIGCDISKNMVQHANRHHANSRNCFRVMDIESELPRDLRECFDHAFSFYTLHWIKRQECAFRNIFDLLVEGGDCLLIFLGHMPVFDVYRVLARSARWRPWLHDVDRFVSPYHDTQEPEKKIRVMMEEIGFRDVEVKRKERSFIYDSIEAVKKAVSAVNPFKIPRDLQEDFMEDYLTVVRDMRLIDRVNNNTDGLSVRANYSLIIAFGRK 273          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|357622483|gb|EHJ73944.1| (juvenile hormone acid methyltransferase [Danaus plexippus])

HSP 1 Score: 368.622 bits (945), Expect = 1.674e-125
Identity = 166/273 (60.81%), Postives = 213/273 (78.02%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNN--KPASIRTNYKLIVVYGSK 308
            MNNAELY  +NTLQKRDA  CLEE+A KI+WK  G+ +IDIGCGDGSVT  +L+ ++P+N ++L+GCDISEKM+ FAN HH  +   FT LDIE +LP +LR  F H FSFYTLHW++ QE AF NI+DLL  GG+CLL FLGH PVFDVYR+LA+S +WS WL+ VDRF+SPYH+ Q+PEK+I +MM  IGF ++ VKC +K+F+Y S EAVKKAV AVNPF +P ++ ++F+ DYV ++RDM+L+D  NNN   P  +RTNY LI+VYG K
Sbjct:    1 MNNAELYHKSNTLQKRDARQCLEEYAKKIKWKSEGDAVIDIGCGDGSVTTNILKTFLPNNCKELIGCDISEKMIQFANEHHAMDNISFTRLDIEGELPDELRERFHHAFSFYTLHWVRQQETAFSNIYDLLVSGGDCLLVFLGHMPVFDVYRLLARSTRWSFWLKDVDRFVSPYHDCQDPEKDIKRMMTTIGFKNVEVKCVQKLFVYTSVEAVKKAVNAVNPFKIPVEMQEEFLEDYVKIVRDMQLVDHVNNNVDGPVHVRTNYNLIIVYGKK 273          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|909573793|ref|XP_013142571.1| (PREDICTED: uncharacterized protein LOC106106522 [Papilio polytes])

HSP 1 Score: 365.925 bits (938), Expect = 1.777e-124
Identity = 168/271 (61.99%), Postives = 215/271 (79.34%), Query Frame = 0
Query:   39 NNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPA-SIRTNYKLIVVYGSK 308
            ++AELY+ +NTLQKRDA++CLEE+A KI+W+   +RIIDIGCGDGSVT  +LR Y+P+N+ +L+GCDIS+ MV  AN HH D R  F V+DIE +LP+DLR  FDH FSFYTLHWIK QE AF NIFDLL  GG+CLL FLGH PVFDVYR+LA+S +W  WL  VDRF+SPYH++QEPEK+I  MM +IGF+D+ VK +E+ FIY+S EAVKKAV AVNPF +P+++ ++FM DY+ V+RDM+LID  NNN    S+R NY L++ +G K
Sbjct:    3 DDAELYKKSNTLQKRDAVECLEEYAIKIKWRNYNDRIIDIGCGDGSVTSNILRSYIPNNYGRLIGCDISKNMVQHANRHHADNRNCFRVMDIESELPRDLRECFDHAFSFYTLHWIKRQECAFRNIFDLLVEGGDCLLIFLGHMPVFDVYRVLARSARWRPWLHDVDRFVSPYHDTQEPEKKIRVMMEEIGFHDVEVKRKERSFIYDSIEAVKKAVSAVNPFKIPQEMQEEFMEDYLAVVRDMRLIDRVNNNTDGLSVRANYSLLIAFGRK 273          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|943962172|ref|XP_014363504.1| (PREDICTED: juvenile hormone acid O-methyltransferase [Papilio machaon] >gi|930670391|gb|KPJ11207.1| Putative methyltransferase 235L [Papilio machaon])

HSP 1 Score: 365.54 bits (937), Expect = 2.336e-124
Identity = 168/271 (61.99%), Postives = 215/271 (79.34%), Query Frame = 0
Query:   39 NNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPA-SIRTNYKLIVVYGSK 308
            ++AELY+ +NTLQKRDA++CLEE+A KI+W+   +RIIDIGCGDGSVT  +LR Y+P+N+ +L+GCDIS+ MV  AN HH + R  F V+DIE +LP+DLR  FDH FSFYTLHWIK QE AF NIFDLL  GG+CLL FLGH PVFDVYR+LA+S +W  WL  VDRF+SPYH++QEPEK+I  MM +IGF D+ VK +E+ FIY+S EAVKKAV AVNPF +P+D+ ++FM DY+ V+RDM+LID  NNN  + S+R NY L++ +G K
Sbjct:    3 DDAELYKKSNTLQKRDAVECLEEYAIKIKWRNYNDRIIDIGCGDGSVTSNILRRYLPNNYGRLIGCDISKNMVQHANRHHANNRNCFRVMDIESELPRDLRECFDHAFSFYTLHWIKRQECAFRNIFDLLVEGGDCLLIFLGHMPVFDVYRVLARSARWRPWLHDVDRFVSPYHDTQEPEKKIRVMMEEIGFRDVEVKRKERSFIYDSIEAVKKAVSAVNPFKIPRDLQEEFMEDYLAVVRDMRLIDRVNNNTDSLSVRANYSLLIAFGRK 273          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|93115166|gb|ABE98256.1| (juvenile hormone acid methyltransferase [Samia ricini])

HSP 1 Score: 355.525 bits (911), Expect = 2.509e-120
Identity = 160/273 (58.61%), Postives = 216/273 (79.12%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNN--KPASIRTNYKLIVVYGSK 308
            M+NA+LY+ +N+LQKRD + CLE++ANKI+WK   +R+IDIGC DGS T  +L++Y+P+N+ KL+GCDISEKMV FAN HH   RT F +L+IE +LP+DL   FDH+FSFYTLHWI+DQE AF NI++LL   G+CLL F+ H P+FDVYRILA+SNKW  WL+ V+R++SPYH+S EPE ++ K+M  IGF +I VKC+E ++ ++  E +KK+V AVNPF MPKD+FDDFM DY+D++RDM+L+DE NNN  +  +IR NY +I+ Y SK
Sbjct:    1 MDNADLYRKSNSLQKRDTLLCLEDYANKIKWKIINDRVIDIGCADGSGTT-MLKKYMPNNYAKLVGCDISEKMVQFANEHHGSGRTSFRMLNIEGELPEDLTGGFDHLFSFYTLHWIRDQEKAFRNIYNLLDESGDCLLLFISHGPIFDVYRILARSNKWCKWLKDVNRYVSPYHDSTEPETDVSKLMKSIGFKNIEVKCKEMMYFFDDIEILKKSVAAVNPFNMPKDIFDDFMDDYIDIVRDMQLVDEVNNNIGEKITIRHNYHIIITYASK 272          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|112982770|ref|NP_001036901.1| (juvenile hormone acid O-methyltransferase [Bombyx mori] >gi|74797537|sp|Q767F1.1|JHAMT_BOMMO RecName: Full=Juvenile hormone acid O-methyltransferase; AltName: Full=Juvenile hormone acid methyltransferase; Short=BmJHAMT >gi|37591031|dbj|BAC98835.1| juvenile hormone acid methyltransferase [Bombyx mori])

HSP 1 Score: 348.977 bits (894), Expect = 1.182e-117
Identity = 158/273 (57.88%), Postives = 214/273 (78.39%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNN--KPASIRTNYKLIVVYGSK 308
            MNNA+LY+ +N+LQKRDA+ CLEE ANKI+WK+ G+R+ID+GC DGSVT  +L+ Y+P N+ +L+GCDISE+MV +AN HH   RT F VLDIE  L  DL+  FDHVFSFYTLHWI+DQE AF NIF+LL   G+CLL FLGH P+FDVYR L+ + KW SWL  VDRFISPYH++++PEKE+ K+M ++GF++I V+C+   ++Y+  + +KK+V A+NPF +PKD+ +DF+ DY+DV+R+M+L+D  NNN  +  SI+ NYK+I VY  K
Sbjct:    1 MNNADLYRKSNSLQKRDALRCLEEHANKIKWKKIGDRVIDLGCADGSVT-DILKVYMPKNYGRLVGCDISEEMVKYANKHHGFGRTSFRVLDIEGDLTADLKQGFDHVFSFYTLHWIRDQERAFRNIFNLLGDEGDCLLLFLGHTPIFDVYRTLSHTEKWHSWLEHVDRFISPYHDNEDPEKEVKKIMERVGFSNIEVQCKTLFYVYDDLDVLKKSVAAINPFNIPKDILEDFLEDYIDVVREMRLLDRCNNNVGESVSIKFNYKVISVYARK 272          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|359391751|gb|AEV45620.1| (juvenile hormone acid methyl transferase [Bombyx mori])

HSP 1 Score: 345.51 bits (885), Expect = 2.361e-116
Identity = 156/273 (57.14%), Postives = 213/273 (78.02%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNN--KPASIRTNYKLIVVYGSK 308
            MNNA+LY+ +N+LQKRDA+ CLEE ANKI+WK+ G+R+ID+GC DGSVT  +L+ Y+P N+ +L+GCDISE+MV +AN HH   RT F VLDIE  L  DL+  FDHVFSFYTLHWI+DQE AF NIF+LL   G+CLL FLGH P+FDVYR L+ + KW SWL  VDRFISPYH++++PEKE+ K+M ++GF++I V+C+   ++Y+  + ++K+V A+NPF +PKD+ +DF+ DY+DV+R+M+L+   NNN  +  SI+ NYK+I VY  K
Sbjct:    1 MNNADLYRKSNSLQKRDALRCLEEHANKIKWKKIGDRVIDLGCADGSVT-DILKVYMPKNYGRLVGCDISEEMVKYANKHHGFGRTSFRVLDIEGDLTADLKQGFDHVFSFYTLHWIRDQERAFRNIFNLLGDEGDCLLLFLGHTPIFDVYRTLSHTEKWHSWLEHVDRFISPYHDNEDPEKEVKKIMERVGFSNIEVQCKTLFYVYDDLDVLRKSVAAINPFNIPKDILEDFLEDYIDVVREMRLLGRCNNNVGESVSIKFNYKVISVYARK 272          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|768432645|ref|XP_011557656.1| (PREDICTED: uncharacterized protein LOC105388451 [Plutella xylostella])

HSP 1 Score: 345.125 bits (884), Expect = 3.254e-116
Identity = 156/272 (57.35%), Postives = 210/272 (77.21%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNN-KPASIRTNYKLIVVYGSK 308
            MN AELY  +N+LQ+RDA++CL+E+A++I+W+  G+R+IDIGCGDGSVT +++R  +     +L+GCD+SE+MV +A  HH+D RT F VLDIE  LP++ R  + H FSFYTLHWI  QE AF NIFDLL PGG+C L FLGH P+FDVYR+L+ S KWS WL  V+++ISPYH S EPEK+I +MM +IGF ++ V+ ++  FIY+  E ++KAV AVNPF +PKD+ D FM DY+DV+RD++L+DE+NNN    SIRT+Y LIV YG+K
Sbjct:    5 MNEAELYHKSNSLQRRDALNCLDEYADRIKWRSEGDRVIDIGCGDGSVTAEVVRARMGRG--RLVGCDLSEQMVKYAAQHHRDARTSFCVLDIEGDLPEEHRGVYHHAFSFYTLHWIHQQEKAFTNIFDLLAPGGDCRLIFLGHMPMFDVYRVLSTSPKWSRWLADVEKYISPYHASLEPEKDIAQMMKRIGFREVEVQYKDSTFIYDKLEILRKAVMAVNPFSIPKDLQDSFMDDYLDVVRDLRLMDEANNNVDSVSIRTHYSLIVAYGTK 274          
BLAST of HiSeq13250 vs. genbank:protein
Match: gi|148596806|dbj|BAF63630.1| (juvenile hormone acid methyltransferase [Helicoverpa armigera])

HSP 1 Score: 343.199 bits (879), Expect = 2.290e-115
Identity = 156/271 (57.56%), Postives = 216/271 (79.70%), Query Frame = 0
Query:   38 MNNAELYQGNNTLQKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEKLLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYTLHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSWLRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAVKKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPASIRTNYKLIVVYGSK 308
            MNNA LY+ +N+LQKRDAI CLEE+A+KI+WK+S   I+DIGCGDGSVT  +L++Y+P  + KLLGCDISEKMV FAN HH +E+T FTVLDIE  LP+ ++  FDHVFSFY LHW+ +QE AF+NI++LL+  GEC   F+   PVFDVYR+LA++NKWS W+  VDR+ISPYH+S EPEK++  M++KIGF DI V+C+E +F+Y++   ++KA+ A+NPF +PK+ +DDFM DY+D+L++++++D+ NNN   S+  NY+L+VVY  K
Sbjct:    1 MNNAVLYEKSNSLQKRDAIMCLEEYASKIKWKKSNNNILDIGCGDGSVT-NMLKKYIPTEY-KLLGCDISEKMVNFANDHHCNEQTSFTVLDIEGDLPEGMKGNFDHVFSFYALHWVNNQERAFKNIYNLLSEDGECFTIFVAWAPVFDVYRVLARNNKWSQWVHDVDRYISPYHDSLEPEKDLKAMIDKIGFVDIDVECKELVFVYDNIHILRKALTAINPFKIPKEKYDDFMEDYMDILKELQILDKYNNNYEKSVEFNYRLLVVYARK 269          
The following BLAST results are available for this feature:
BLAST of HiSeq13250 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1181738908|gb|ARI71313.1|2.218e-14673.48juvenile hormone acid methyltransferase [Chilo sup... [more]
gi|910314749|ref|XP_013181602.1|1.232e-12562.73PREDICTED: juvenile hormone acid O-methyltransfera... [more]
gi|357622483|gb|EHJ73944.1|1.674e-12560.81juvenile hormone acid methyltransferase [Danaus pl... [more]
gi|909573793|ref|XP_013142571.1|1.777e-12461.99PREDICTED: uncharacterized protein LOC106106522 [P... [more]
gi|943962172|ref|XP_014363504.1|2.336e-12461.99PREDICTED: juvenile hormone acid O-methyltransfera... [more]
gi|93115166|gb|ABE98256.1|2.509e-12058.61juvenile hormone acid methyltransferase [Samia ric... [more]
gi|112982770|ref|NP_001036901.1|1.182e-11757.88juvenile hormone acid O-methyltransferase [Bombyx ... [more]
gi|359391751|gb|AEV45620.1|2.361e-11657.14juvenile hormone acid methyl transferase [Bombyx m... [more]
gi|768432645|ref|XP_011557656.1|3.254e-11657.35PREDICTED: uncharacterized protein LOC105388451 [P... [more]
gi|148596806|dbj|BAF63630.1|2.290e-11557.56juvenile hormone acid methyltransferase [Helicover... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006718 juvenile hormone biosynthetic process
biological_process GO:0032259 methylation
molecular_function GO:0019010 farnesoic acid O-methyltransferase activity
molecular_function GO:0035049 juvenile hormone acid methyltransferase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseGENE3D3.40.50.150coord: 61..306
e-value: 8.6E-30
score: 103.5
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILY53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 59..274
IPR025714Methyltransferase domainPFAMPF13847Methyltransf_31coord: 70..180
e-value: 2.7E-20
score: 72.3
NoneNo IPR availablePANTHERPTHR10108:SF760JUVENILE HORMONE ACID METHYLTRANSFERASEcoord: 38..308
NoneNo IPR availablePANTHERPTHR10108METHYLTRANSFERASEcoord: 38..308

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13250HiSeq13250Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13250_p ID=HiSeq13250_p|Name=HiSeq13250|organism=Ostrinia scapulalis|type=polypeptide|length=308bp
MHTYAAPAASVRRKRARLSHLAHAQPTNTRKIQLILNMNNAELYQGNNTL
QKRDAIDCLEEFANKIRWKRSGERIIDIGCGDGSVTVKLLREYVPDNFEK
LLGCDISEKMVAFANLHHKDERTDFTVLDIERKLPKDLRNAFDHVFSFYT
LHWIKDQELAFENIFDLLTPGGECLLSFLGHNPVFDVYRILAQSNKWSSW
LRGVDRFISPYHESQEPEKEIWKMMNKIGFNDISVKCQEKIFIYNSPEAV
KKAVQAVNPFPMPKDVFDDFMLDYVDVLRDMKLIDESNNNKPASIRTNYK
LIVVYGSK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0019010farnesoic acid O-methyltransferase activity
GO:0035049juvenile hormone acid methyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0032259methylation
GO:0006718juvenile hormone biosynthetic process
Vocabulary: INTERPRO
TermDefinition
IPR025714Methyltranfer_dom
IPR029063SAM-dependent_MTases