HiSeq13254_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13254
Unique NameHiSeq13254_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length106
Homology
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|910316073|ref|XP_013182326.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Papilio xuthus])

HSP 1 Score: 160.999 bits (406), Expect = 3.165e-46
Identity = 75/106 (70.75%), Postives = 90/106 (84.91%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MA++DY+++PI  K L+ PP+EE+ DVLSR L+SNF TVEVS   CPDLTQPPF L +PG++GN  LVEIGGPPYLVP V+RDK+YDLAALLRHLRR+PALL GAG
Sbjct:   34 MATVDYTKVPIQTKALYVPPLEEIADVLSRELRSNFETVEVSVVDCPDLTQPPFDLQAPGISGNATLVEIGGPPYLVPLVQRDKVYDLAALLRHLRRDPALLVGAG 139          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|910316071|ref|XP_013182325.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X1 [Papilio xuthus])

HSP 1 Score: 160.614 bits (405), Expect = 5.077e-46
Identity = 75/106 (70.75%), Postives = 90/106 (84.91%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MA++DY+++PI  K L+ PP+EE+ DVLSR L+SNF TVEVS   CPDLTQPPF L +PG++GN  LVEIGGPPYLVP V+RDK+YDLAALLRHLRR+PALL GAG
Sbjct:   41 MATVDYTKVPIQTKALYVPPLEEIADVLSRELRSNFETVEVSVVDCPDLTQPPFDLQAPGISGNATLVEIGGPPYLVPLVQRDKVYDLAALLRHLRRDPALLVGAG 146          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|930658003|gb|KPJ00218.1| (Ester hydrolase C11orf54-like [Papilio xuthus])

HSP 1 Score: 160.229 bits (404), Expect = 6.226e-46
Identity = 75/106 (70.75%), Postives = 90/106 (84.91%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MA++DY+++PI  K L+ PP+EE+ DVLSR L+SNF TVEVS   CPDLTQPPF L +PG++GN  LVEIGGPPYLVP V+RDK+YDLAALLRHLRR+PALL GAG
Sbjct:   41 MATVDYTKVPIQTKALYVPPLEEIADVLSRELRSNFETVEVSVVDCPDLTQPPFDLQAPGISGNATLVEIGGPPYLVPLVQRDKVYDLAALLRHLRRDPALLVGAG 146          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|943959181|ref|XP_014362240.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Papilio machaon] >gi|943959184|ref|XP_014362241.1| PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Papilio machaon])

HSP 1 Score: 154.066 bits (388), Expect = 7.391e-44
Identity = 72/106 (67.92%), Postives = 88/106 (83.02%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MA++DY+++PI  K L+ PP+EE+ DVLS  L+S F TVEVS   CPDLTQPPF L +PG++GN  LVEIGGPPYL+P V+RDK+YDLAALLRHLRR+PALL GAG
Sbjct:    1 MATVDYAKVPIQTKALYVPPLEEMADVLSHELRSTFETVEVSVVDCPDLTQPPFDLQAPGISGNATLVEIGGPPYLMPLVQRDKVYDLAALLRHLRRDPALLTGAG 106          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|943959179|ref|XP_014362239.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X1 [Papilio machaon])

HSP 1 Score: 154.066 bits (388), Expect = 1.455e-43
Identity = 72/106 (67.92%), Postives = 88/106 (83.02%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MA++DY+++PI  K L+ PP+EE+ DVLS  L+S F TVEVS   CPDLTQPPF L +PG++GN  LVEIGGPPYL+P V+RDK+YDLAALLRHLRR+PALL GAG
Sbjct:   33 MATVDYAKVPIQTKALYVPPLEEMADVLSHELRSTFETVEVSVVDCPDLTQPPFDLQAPGISGNATLVEIGGPPYLMPLVQRDKVYDLAALLRHLRRDPALLTGAG 138          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|827536294|ref|XP_012551529.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Bombyx mori] >gi|827536296|ref|XP_012551558.1| PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Bombyx mori] >gi|827536298|ref|XP_012551600.1| PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Bombyx mori])

HSP 1 Score: 151.369 bits (381), Expect = 8.500e-43
Identity = 71/106 (66.98%), Postives = 87/106 (82.08%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            M S+DY+++ I EK L+TPP++EV  VLS GL +NF  VEVS A  PDLT+PP++L SPGLTG+ KLVEIGGPPYLVP+V+RDK+YDLA LL HL R+PA LAGAG
Sbjct:    1 MTSIDYTKVTIKEKELYTPPLDEVACVLSNGLTTNFKFVEVSVADSPDLTEPPYYLKSPGLTGDAKLVEIGGPPYLVPQVKRDKIYDLAKLLEHLNRDPAFLAGAG 106          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|827536292|ref|XP_012551475.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X1 [Bombyx mori])

HSP 1 Score: 151.754 bits (382), Expect = 9.700e-43
Identity = 71/106 (66.98%), Postives = 87/106 (82.08%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            M S+DY+++ I EK L+TPP++EV  VLS GL +NF  VEVS A  PDLT+PP++L SPGLTG+ KLVEIGGPPYLVP+V+RDK+YDLA LL HL R+PA LAGAG
Sbjct:   27 MTSIDYTKVTIKEKELYTPPLDEVACVLSNGLTTNFKFVEVSVADSPDLTEPPYYLKSPGLTGDAKLVEIGGPPYLVPQVKRDKIYDLAKLLEHLNRDPAFLAGAG 132          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|909551238|ref|XP_013139218.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X2 [Papilio polytes])

HSP 1 Score: 151.754 bits (382), Expect = 1.036e-42
Identity = 73/106 (68.87%), Postives = 86/106 (81.13%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            M ++DY+++PI  K L  PP+EE+ DVLSR L S F TVEVS   CPDLTQ PF L +PG++GN  LVEIGGPPYLVP V+RDK+YDLAALLRHLRR+PALLAGAG
Sbjct:   33 MTTVDYAKVPIQTKALHVPPLEEMADVLSRELLSTFETVEVSVVDCPDLTQQPFDLQAPGISGNATLVEIGGPPYLVPLVQRDKVYDLAALLRHLRRDPALLAGAG 138          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|909551236|ref|XP_013139210.1| (PREDICTED: ester hydrolase C11orf54 homolog isoform X1 [Papilio polytes])

HSP 1 Score: 151.369 bits (381), Expect = 1.595e-42
Identity = 73/106 (68.87%), Postives = 86/106 (81.13%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            M ++DY+++PI  K L  PP+EE+ DVLSR L S F TVEVS   CPDLTQ PF L +PG++GN  LVEIGGPPYLVP V+RDK+YDLAALLRHLRR+PALLAGAG
Sbjct:   39 MTTVDYAKVPIQTKALHVPPLEEMADVLSRELLSTFETVEVSVVDCPDLTQQPFDLQAPGISGNATLVEIGGPPYLVPLVQRDKVYDLAALLRHLRRDPALLAGAG 144          
BLAST of HiSeq13254 vs. genbank:protein
Match: gi|913335588|ref|XP_013199568.1| (PREDICTED: ester hydrolase C11orf54 homolog [Amyelois transitella])

HSP 1 Score: 148.288 bits (373), Expect = 9.807e-42
Identity = 72/106 (67.92%), Postives = 83/106 (78.30%), Query Frame = 0
Query:    1 MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLTQPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPALLAGAG 106
            MAS+DYSQ+PI EKP   PP+ EV DVLSRGL + F  V V+   CPDLT+PPF LT+ GL G+ KLVE+GGPPYLVP V+RDKLYDLAAL RHL R+PA L GAG
Sbjct:    1 MASVDYSQVPIKEKPFHKPPLTEVADVLSRGLTATFEAVSVAVVECPDLTRPPFNLTTQGLCGDPKLVELGGPPYLVPLVQRDKLYDLAALTRHLHRDPANLVGAG 106          
The following BLAST results are available for this feature:
BLAST of HiSeq13254 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910316073|ref|XP_013182326.1|3.165e-4670.75PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|910316071|ref|XP_013182325.1|5.077e-4670.75PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|930658003|gb|KPJ00218.1|6.226e-4670.75Ester hydrolase C11orf54-like [Papilio xuthus][more]
gi|943959181|ref|XP_014362240.1|7.391e-4467.92PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|943959179|ref|XP_014362239.1|1.455e-4367.92PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|827536294|ref|XP_012551529.1|8.500e-4366.98PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|827536292|ref|XP_012551475.1|9.700e-4366.98PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|909551238|ref|XP_013139218.1|1.036e-4268.87PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|909551236|ref|XP_013139210.1|1.595e-4268.87PREDICTED: ester hydrolase C11orf54 homolog isofor... [more]
gi|913335588|ref|XP_013199568.1|9.807e-4267.92PREDICTED: ester hydrolase C11orf54 homolog [Amyel... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0016787 hydrolase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015021Domain of unknown function DUF1907PFAMPF08925DUF1907coord: 27..106
e-value: 1.9E-22
score: 79.5
NoneNo IPR availablePANTHERPTHR13204PTD012 PROTEINcoord: 2..106
NoneNo IPR availableSUPERFAMILY117856AF0104/ALDC/Ptd012-likecoord: 12..106

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13254HiSeq13254Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13254_p ID=HiSeq13254_p|Name=HiSeq13254|organism=Ostrinia scapulalis|type=polypeptide|length=106bp
MASLDYSQLPITEKPLFTPPVEEVVDVLSRGLKSNFATVEVSAAPCPDLT
QPPFFLTSPGLTGNEKLVEIGGPPYLVPRVRRDKLYDLAALLRHLRREPA
LLAGAG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR015021DUF1907