HiSeq13256_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13256
Unique NameHiSeq13256_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length482
Homology
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|512916060|ref|XP_004928540.1| (PREDICTED: LOW QUALITY PROTEIN: mitochondrial-processing peptidase subunit alpha-like [Bombyx mori])

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 425/483 (87.99%), Postives = 455/483 (94.20%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDA-PQGRRINLFRA 482
            M +LPPV YS AKSE+  TEVT LSNGLRVASEKKFGQFCTAGVVIDSGPRYEV+YPNGI HFLEKLSFGATHK+ATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRP LS +EIEAARQAVAFELETL+MRPEQETILMDMIH+AAYKGNTLGLPKICP ENV KID+ IIL YLKNHY+P RMVVAAVGV+H PFVEFVQKYFVD+KPTW+T+  E+   +VD SI+QYTGGI+QEECEIPLYPGSDLPELSH+VIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVH+ASPPNRIYDTT+VIARELANMAGKVGE EL+RAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEI+KITADDIVRVA+RML  +PAVA RGKLAHLP+F+EIQ+N+SL+  DA PQGRR+NLFRA
Sbjct:   55 MLNLPPVKYSLAKSEETITEVTTLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVAYPNGIXHFLEKLSFGATHKFATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPILSADEIEAARQAVAFELETLSMRPEQETILMDMIHSAAYKGNTLGLPKICPQENVNKIDKGIILNYLKNHYTPDRMVVAAVGVDHEPFVEFVQKYFVDIKPTWYTDGDESFVPKVDKSISQYTGGIEQEECEIPLYPGSDLPELSHIVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHAASPPNRIYDTTLVIARELANMAGKVGEIELRRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIDKITADDIVRVAQRMLSGRPAVAGRGKLAHLPTFDEIQSNMSLNKRDAPPQGRRLNLFRA 537          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|913327717|ref|XP_013195327.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Amyelois transitella])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 425/482 (88.17%), Postives = 452/482 (93.78%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFRA 482
            +P LPPV YSTA SEDA TEVT LSNGLRVASEKKFGQFCTAGVVIDSGPRYEV YPNGICHFLEKLSFGAT+K+ TRDVML ELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLS++EIEAARQAVAFELETL+MRPEQETILMDMIHAAAYK NTLGLPKICP +N+ KIDR  IL +LKNHY+P RMVVAAVGV+H PFVE+VQKYFVD KPTW +E+  N   +VD SIA+YTGG+QQEECEIPLYPGSDLPELSHVVIGLESCSH DPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVH+ASPPNRIYDTTIVIARELANMAGKVGE+EL+RAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITA+DI RVARRMLG + +VAARGKL HLPSF+EIQAN++LS SDAPQGRR+NLFRA
Sbjct:   57 IPSLPPVVYSTAISEDAITEVTTLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVEYPNGICHFLEKLSFGATNKFPTRDVMLLELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSSDEIEAARQAVAFELETLSMRPEQETILMDMIHAAAYKDNTLGLPKICPHQNMLKIDRGAILNFLKNHYTPDRMVVAAVGVDHEPFVEYVQKYFVDTKPTWSSED--NFKPKVDKSIAKYTGGMQQEECEIPLYPGSDLPELSHVVIGLESCSHSDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHAASPPNRIYDTTIVIARELANMAGKVGESELRRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITAEDITRVARRMLGSRASVAARGKLTHLPSFDEIQANMTLS-SDAPQGRRLNLFRA 535          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|768413292|ref|XP_011568759.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Plutella xylostella])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 416/483 (86.13%), Postives = 454/483 (94.00%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTE-ETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFRA 482
            MP+LP V Y ++K+E+  TE+T LSNGLRVASEKKFGQFCTAGVVIDSGPRYEV+YPNGICHFLEKLSFGATHK++TRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRP+LS +E+EAARQAVAFELETL+MRPEQETILMDMIHAAAY+GNTLGLPKICP ENV KIDR +IL YL+NHY+P RMVVAAVGVEH PFVEFVQKYFVDMKPTW +E ET  +   VD SI+QYTGG++QEECE+PLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVH+ASPP+RI+DT +V+ARELANMAGKVGE ELKRAKTQLQSMLLMNLEARPVVFED+GRQVLATG+RKPPS+FINEI K+TADD+VRVA R+L  +PAVAARGKLAHLP+FEEIQANI+L  +DAPQGRRINLFRA
Sbjct:   50 MPNLPDVLYQSSKAEEYVTEITTLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVAYPNGICHFLEKLSFGATHKFSTRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPRLSTDEVEAARQAVAFELETLSMRPEQETILMDMIHAAAYRGNTLGLPKICPHENVNKIDRGVILNYLQNHYTPDRMVVAAVGVEHKPFVEFVQKYFVDMKPTWQSEGETTKT---VDTSISQYTGGMEQEECEVPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHAASPPSRIHDTALVVARELANMAGKVGENELKRAKTQLQSMLLMNLEARPVVFEDIGRQVLATGRRKPPSYFINEIAKVTADDVVRVATRLLSSKPAVAARGKLAHLPTFEEIQANIAL-KTDAPQGRRINLFRA 528          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|943937618|ref|XP_014370634.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Papilio machaon])

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 409/483 (84.68%), Postives = 447/483 (92.55%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSD-APQGRRINLFRA 482
            +P+LPP+ YS+AKSEDA TEVTVL NGLRVASEKKFGQFCTAGVVIDSGPRYEV+YP+GICHFLEKLSFGATHK+ TRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEA+TQVLAEVTLRPQLS +E+EAARQAVAFELETL+MRPEQETILMDMIHAAAYKGNTLGLPKICP ENV+KIDR  I+ YLKNHY+P RMVVAAVGVEHGPFVE+VQKYFVDMKP W++E  +     VD S+A+YTGGI QEECEIPLYPGSDLPELSHVVIG+ESCSH  PDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGD+G+FCVH+ASPP R++DT ++IAREL+ MAG V   EL+RAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPS+FINEIEKITADDIVRVA  ML K+ AVAARGKL HLP+FEEIQAN+SL+ S+ +PQGRR+NLFRA
Sbjct:   51 VPNLPPIVYSSAKSEDALTEVTVLGNGLRVASEKKFGQFCTAGVVIDSGPRYEVAYPSGICHFLEKLSFGATHKFPTRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAITQVLAEVTLRPQLSTDEVEAARQAVAFELETLSMRPEQETILMDMIHAAAYKGNTLGLPKICPVENVHKIDRGTIINYLKNHYTPDRMVVAAVGVEHGPFVEYVQKYFVDMKPMWNSESNDLIKSNVDKSVAKYTGGIVQEECEIPLYPGSDLPELSHVVIGIESCSHSHPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDSGVFCVHAASPPARLHDTALLIARELSAMAGNVAVNELRRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSYFINEIEKITADDIVRVATTMLSKRAAVAARGKLTHLPTFEEIQANMSLNKSETSPQGRRLNLFRA 533          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|930679334|gb|KPJ19204.1| (Mitochondrial-processing peptidase subunit alpha [Papilio machaon])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 409/483 (84.68%), Postives = 447/483 (92.55%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSD-APQGRRINLFRA 482
            +P+LPP+ YS+AKSEDA TEVTVL NGLRVASEKKFGQFCTAGVVIDSGPRYEV+YP+GICHFLEKLSFGATHK+ TRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEA+TQVLAEVTLRPQLS +E+EAARQAVAFELETL+MRPEQETILMDMIHAAAYKGNTLGLPKICP ENV+KIDR  I+ YLKNHY+P RMVVAAVGVEHGPFVE+VQKYFVDMKP W++E  +     VD S+A+YTGGI QEECEIPLYPGSDLPELSHVVIG+ESCSH  PDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGD+G+FCVH+ASPP R++DT ++IAREL+ MAG V   EL+RAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPS+FINEIEKITADDIVRVA  ML K+ AVAARGKL HLP+FEEIQAN+SL+ S+ +PQGRR+NLFRA
Sbjct:   50 VPNLPPIVYSSAKSEDALTEVTVLGNGLRVASEKKFGQFCTAGVVIDSGPRYEVAYPSGICHFLEKLSFGATHKFPTRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAITQVLAEVTLRPQLSTDEVEAARQAVAFELETLSMRPEQETILMDMIHAAAYKGNTLGLPKICPVENVHKIDRGTIINYLKNHYTPDRMVVAAVGVEHGPFVEYVQKYFVDMKPMWNSESNDLIKSNVDKSVAKYTGGIVQEECEIPLYPGSDLPELSHVVIGIESCSHSHPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDSGVFCVHAASPPARLHDTALLIARELSAMAGNVAVNELRRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSYFINEIEKITADDIVRVATTMLSKRAAVAARGKLTHLPTFEEIQANMSLNKSETSPQGRRLNLFRA 532          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|910326970|ref|XP_013166648.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Papilio xuthus] >gi|930650906|gb|KPI93250.1| Mitochondrial-processing peptidase subunit alpha [Papilio xuthus])

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 407/483 (84.27%), Postives = 446/483 (92.34%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSD-APQGRRINLFRA 482
            +P+LPP+ YS+AKSEDA TEVTVL+NGLRVASEKKFGQFCTAGVVIDSGPRYEV+YP+GICHFLEKLSFGATHK+ TRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEA+TQVLAEVTLRPQLS +E+EAARQAVAFELETL+MRPEQETILMDMIHAAAYKGNTLGLPKICP ENV+KIDR  I+ YLKNHY+P RMVVAAVGVEHGPFVE+VQKYFVDMKP W+ E+       VD S AQYTGGI QEECEIPLYPGSDLPELSHVVIG+ESCSH  PDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGD+G+FCVH+A+PP R++DT ++IAREL+ MAG V   EL+RAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPS+FINEIEKITADDI+RVA  ML K+ +VAARGKL HLP+FEEIQAN+SL+ S+ +PQGRR+NLFRA
Sbjct:   51 VPNLPPIVYSSAKSEDALTEVTVLNNGLRVASEKKFGQFCTAGVVIDSGPRYEVAYPSGICHFLEKLSFGATHKFPTRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAITQVLAEVTLRPQLSTDEVEAARQAVAFELETLSMRPEQETILMDMIHAAAYKGNTLGLPKICPVENVHKIDRGTIINYLKNHYTPDRMVVAAVGVEHGPFVEYVQKYFVDMKPMWNLEDNNLIKPNVDKSAAQYTGGIVQEECEIPLYPGSDLPELSHVVIGIESCSHSHPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDSGVFCVHAAAPPTRLHDTALLIARELSAMAGNVAAAELRRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSYFINEIEKITADDIIRVATTMLTKRASVAARGKLTHLPTFEEIQANMSLNKSETSPQGRRLNLFRA 533          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|545917002|gb|JAB57183.1| (putative mitochondrial processing peptidase alpha subunit [Corethrella appendiculata])

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 319/482 (66.18%), Postives = 386/482 (80.08%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETEN-SAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFR 481
            +P LPPV Y++ KSE   T+VT LSNGLRVASE +FGQFCT GVVIDSGPRYEV+YPNG+ HFLEKL+F +TH+Y+ +DV+ +ELE+HGGICDCQ SRDT VYA SADSRGLE+VT++LAEV LRP+L  EEI+ A+QA+ FELE+L MRPEQE ILMDMIHAAAY+ NTLG PK CP +NV ++DRN++L YLK H++P RMV+A VGV H   V+   KYFV+ +P W +E+  N  A  VD SIAQYTGG + EEC+IP+Y    LPEL+H+VIGL+ CSH D DFVA CVLN+MMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWM++ATAYNHAYGDTGLFC+H+ +PP  + +   VI REL  M  + GE EL+RAKTQLQSMLLMNLEARPVVFED+GRQVLATG+RK P  FI EIEKITA+DI  VARR L   P++AARG++  LP  ++IQA    ++   P  +R++LFR
Sbjct:   65 IPDLPPVQYASVKSEQNATQVTTLSNGLRVASENRFGQFCTVGVVIDSGPRYEVAYPNGVSHFLEKLAFLSTHEYSDKDVISKELEKHGGICDCQSSRDTFVYAASADSRGLESVTKILAEVVLRPRLEFEEIDLAKQAIQFELESLNMRPEQEPILMDMIHAAAYRDNTLGFPKFCPLDNVNQVDRNMLLNYLKYHHTPQRMVLAGVGVNHDDLVKLADKYFVEKQPIWESEKIVNCGATAVDTSIAQYTGGSKIEECDIPIYAAVGLPELAHIVIGLKGCSHQDKDFVAACVLNIMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHAYGDTGLFCIHATAPPTHVRNMVEVITRELYTMQSRPGEQELRRAKTQLQSMLLMNLEARPVVFEDIGRQVLATGERKRPEHFIEEIEKITAEDIQNVARRFLSSPPSLAARGEIKGLPDVKDIQAGF-FNDGRLPGNKRLSLFR 545          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|1080049633|ref|XP_018566230.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Anoplophora glabripennis])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 315/480 (65.62%), Postives = 381/480 (79.38%), Query Frame = 0
Query:    4 LPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTE-ETENSA-IEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFR 481
            LP   Y+  K ++  T VTVL NGL VASE +FG+FCT GVVIDSG RYEV+YP+GI HFLEKL+F +T  Y  RD ++ +LE+HGGICD Q SRDT +YA SA + GL  V Q+L+E TLRPQ++ EE++AARQA+ FELETL MRPEQET+LMDMIHAAAY+ NTLGLPK+CP +N+ KIDR+++  YL  HY+P RMV+A VGVEH   V+ VQKYFVD+KP W TE E EN   +  D S+AQYTGG+ QEEC+IP +  + LP LSH++IGLESCSH D DF+A CVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWM++ATAYNHAY DTGLFC+H+++PP  + D   VI +E+ NMAG V + EL+RAKTQLQSMLLMNLE+RPV+FED+GRQVLATG RK P +FI+EIEKIT DDI+ VARR+L  QPAVAARG L  +PS E IQA +  S    P GR+++LFR
Sbjct:   64 LPKPIYANFKEDNQKTRVTVLPNGLTVASENRFGEFCTVGVVIDSGSRYEVAYPSGISHFLEKLAFNSTKYYPDRDEIINKLEKHGGICDSQASRDTFIYAASAYTSGLGDVIQLLSEATLRPQITAEEVDAARQAIHFELETLNMRPEQETLLMDMIHAAAYRDNTLGLPKLCPPQNLNKIDRDMLFTYLDQHYTPKRMVIAGVGVEHFKLVDAVQKYFVDVKPLWETETELENRKNLGCDRSLAQYTGGMVQEECDIPQFASAGLPVLSHIMIGLESCSHQDKDFIAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHAYSDTGLFCIHASAPPTHVRDMVEVIVKEMVNMAGNVSDQELRRAKTQLQSMLLMNLESRPVMFEDIGRQVLATGHRKRPKYFIDEIEKITKDDIISVARRLLSSQPAVAARGDLRKMPSLEYIQAGLIDSEGKMPSGRKLSLFR 543          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|1130256694|ref|XP_019768280.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha isoform X1 [Dendroctonus ponderosae] >gi|478251961|gb|ENN72399.1| hypothetical protein YQE_11033, partial [Dendroctonus ponderosae])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 311/480 (64.79%), Postives = 381/480 (79.38%), Query Frame = 0
Query:    4 LPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEET--ENSAIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFR 481
            LP   Y+  + E+ HT+VT++ NGLRVASE +FG+FCT GVVIDSG RYEV+YP+GI HFLEKL+F +T  Y  RD ++ +LE+HGGICD Q SRDT +YA SA + GL  V Q+LAE TLRPQ++ EE++ A+QA+ FELETL MRPEQETILMDMIHAAAY+ NTLGLPK+CP++N+ KIDR ++  YL  HY+P RMVVA VGVEH   VE VQKYFVD KP W  E+   + +   VD S+AQYTGGI+QEEC+IP +  + LP LSH++IGLE CSH D DF+A CVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWM++ATAYNHAY DTGLFC+H+++PPN + D   VI +EL NMA  +G+ EL+RAKTQLQSMLLMNLE+RPV+FED+GRQVLAT  RK P +FI EIEKIT DDIV+VA+R+L  QP+VAARG L  +PS E IQA +  +    P GR+++L+R
Sbjct:   60 LPKAIYANFREENQHTKVTIMPNGLRVASENRFGEFCTVGVVIDSGSRYEVAYPSGISHFLEKLAFNSTKHYPDRDEIINKLEKHGGICDSQASRDTFIYAASAYTTGLNDVIQLLAEATLRPQITPEEVDGAKQAIHFELETLHMRPEQETILMDMIHAAAYRDNTLGLPKLCPSKNLDKIDREMLFLYLSQHYTPQRMVVAGVGVEHERLVEAVQKYFVDSKPLWEMEQLFGKKNISGVDKSVAQYTGGIEQEECDIPQFASAGLPVLSHIMIGLEGCSHQDSDFIAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHAYNDTGLFCIHASAPPNYVRDMVEVIVKELVNMASSIGDQELRRAKTQLQSMLLMNLESRPVMFEDIGRQVLATAHRKRPEYFIKEIEKITKDDIVQVAKRLLMSQPSVAARGDLRKMPSLEYIQAGLIDTEGKMPSGRKLSLWR 539          
BLAST of HiSeq13256 vs. genbank:protein
Match: gi|929371559|ref|XP_014095703.1| (PREDICTED: mitochondrial-processing peptidase subunit alpha [Bactrocera oleae])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 311/482 (64.52%), Postives = 386/482 (80.08%), Query Frame = 0
Query:    1 MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGPRYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDTTVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMRPEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSPSRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENS-AIEVDNSIAQYTGGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSASPPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVFEDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGKLAHLPSFEEIQANISLSNSDAPQGRRINLFR 481
            +P+LP V Y+   +E + T+VT L NGLRVASE +FGQFCT G+VIDSGPRYEV+YP+G+ HFLEKL+F +T K+  +D +L+ELE++GGICDCQ SRDT +YA S DSR +E+VT++LA+VTLRP L   E+ AAR+AV FELETL MRPEQE ILMDMIHAAAY+ NTLGLPK+CP+EN+  IDRN+++ YLK H++P RMV+A VGV H   V  V+KYFVD K  W T+  + + A EVD S+AQYTGG+++EECEIP+Y  + LPEL+HVVIGLE CSH DPDFVA CVLN+MMGGGGSFSAGGPGKGMY+RLYTNVLNRYHWM++ATAYNHAY DTGLFC+H+++PP+ + D   VI REL NMA + G  EL R+K QLQSMLLMNLE+RPVVFEDVGRQVLATG RK P  FI+EIEKI+  DI RVARR+L   P++AARG +  LP  +++Q+  +LSN      RR++LF+
Sbjct:   71 IPNLPEVEYARPLAESSLTQVTTLPNGLRVASEPRFGQFCTVGLVIDSGPRYEVTYPSGVSHFLEKLAFNSTEKFPNKDAILKELEKNGGICDCQSSRDTLIYAASIDSRAIESVTRLLADVTLRPTLHAAEVSAARKAVQFELETLGMRPEQEPILMDMIHAAAYRDNTLGLPKLCPSENLSLIDRNVLMNYLKYHHTPQRMVIAGVGVNHDELVRNVEKYFVDEKAIWETQVIKGTGATEVDGSVAQYTGGLKKEECEIPIYAATGLPELAHVVIGLEGCSHQDPDFVALCVLNIMMGGGGSFSAGGPGKGMYSRLYTNVLNRYHWMYSATAYNHAYADTGLFCIHASAPPSNVRDMVEVITRELVNMASEPGRDELSRSKIQLQSMLLMNLESRPVVFEDVGRQVLATGHRKRPEHFIHEIEKISQGDIQRVARRLLATVPSMAARGDIGKLPEMKDVQS--ALSNGGRLSSRRLSLFK 550          
The following BLAST results are available for this feature:
BLAST of HiSeq13256 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|512916060|ref|XP_004928540.1|0.000e+087.99PREDICTED: LOW QUALITY PROTEIN: mitochondrial-proc... [more]
gi|913327717|ref|XP_013195327.1|0.000e+088.17PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|768413292|ref|XP_011568759.1|0.000e+086.13PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|943937618|ref|XP_014370634.1|0.000e+084.68PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|930679334|gb|KPJ19204.1|0.000e+084.68Mitochondrial-processing peptidase subunit alpha [... [more]
gi|910326970|ref|XP_013166648.1|0.000e+084.27PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|545917002|gb|JAB57183.1|0.000e+066.18putative mitochondrial processing peptidase alpha ... [more]
gi|1080049633|ref|XP_018566230.1|0.000e+065.63PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|1130256694|ref|XP_019768280.1|0.000e+064.79PREDICTED: mitochondrial-processing peptidase subu... [more]
gi|929371559|ref|XP_014095703.1|0.000e+064.52PREDICTED: mitochondrial-processing peptidase subu... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006627 protein processing involved in protein targeting to mitochondrion
cellular_component GO:0005743 mitochondrial inner membrane
molecular_function GO:0003824 catalytic activity
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004222 metalloendopeptidase activity
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011237Peptidase M16 domainGENE3D3.30.830.10coord: 248..459
e-value: 4.5E-64
score: 215.2
IPR011237Peptidase M16 domainGENE3D3.30.830.10coord: 17..224
e-value: 3.6E-53
score: 179.6
IPR011765Peptidase M16, N-terminalPFAMPF00675Peptidase_M16coord: 29..178
e-value: 1.9E-33
score: 115.1
IPR007863Peptidase M16, C-terminal domainPFAMPF05193Peptidase_M16_Ccoord: 184..385
e-value: 5.2E-33
score: 114.1
NoneNo IPR availablePANTHERPTHR11851METALLOPROTEASEcoord: 1..477
NoneNo IPR availablePANTHERPTHR11851:SF49MITOCHONDRIAL-PROCESSING PEPTIDASE SUBUNIT ALPHAcoord: 1..477
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILY63411LuxS/MPP-like metallohydrolasecoord: 270..459
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILY63411LuxS/MPP-like metallohydrolasecoord: 18..230

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13256HiSeq13256Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13256_p ID=HiSeq13256_p|Name=HiSeq13256|organism=Ostrinia scapulalis|type=polypeptide|length=482bp
MPHLPPVSYSTAKSEDAHTEVTVLSNGLRVASEKKFGQFCTAGVVIDSGP
RYEVSYPNGICHFLEKLSFGATHKYATRDVMLRELERHGGICDCQGSRDT
TVYATSADSRGLEAVTQVLAEVTLRPQLSNEEIEAARQAVAFELETLAMR
PEQETILMDMIHAAAYKGNTLGLPKICPTENVYKIDRNIILKYLKNHYSP
SRMVVAAVGVEHGPFVEFVQKYFVDMKPTWHTEETENSAIEVDNSIAQYT
GGIQQEECEIPLYPGSDLPELSHVVIGLESCSHGDPDFVATCVLNMMMGG
GGSFSAGGPGKGMYTRLYTNVLNRYHWMFNATAYNHAYGDTGLFCVHSAS
PPNRIYDTTIVIARELANMAGKVGETELKRAKTQLQSMLLMNLEARPVVF
EDVGRQVLATGKRKPPSFFINEIEKITADDIVRVARRMLGKQPAVAARGK
LAHLPSFEEIQANISLSNSDAPQGRRINLFRA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0003824catalytic activity
GO:0046872metal ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006627protein processing involved in protein targeting to mitochondrion
Vocabulary: Cellular Component
TermDefinition
GO:0005743mitochondrial inner membrane
Vocabulary: INTERPRO
TermDefinition
IPR011249Metalloenz_LuxS/M16
IPR007863Peptidase_M16_C
IPR011765Pept_M16_N
IPR011237Pept_M16_dom