HiSeq13258_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13258
Unique NameHiSeq13258_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length227
Homology
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|512914401|ref|XP_004928133.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein [Bombyx mori])

HSP 1 Score: 424.091 bits (1089), Expect = 1.389e-149
Identity = 208/226 (92.04%), Postives = 215/226 (95.13%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            MPSMKVEGDSDGDG+MSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDE ECERRRNECLDNLA LERQFTVLREQLY ERVK VEYQLAEVRGGRSQEY GPLRRLQENMR+RIEVAGILKQ RIENIKHK+EAEEQAAHQH+KSEKWLAYE LKE+I EKIRKLEEERHTVDLW S  EWG+RRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERA+
Sbjct:    1 MPSMKVEGDSDGDGEMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDEGECERRRNECLDNLAKLERQFTVLREQLYVERVKQVEYQLAEVRGGRSQEYLGPLRRLQENMRIRIEVAGILKQMRIENIKHKFEAEEQAAHQHFKSEKWLAYENLKEDILEKIRKLEEERHTVDLWSSAPEWGKRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAE 226          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|913322227|ref|XP_013192315.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein [Amyelois transitella])

HSP 1 Score: 396.741 bits (1018), Expect = 9.735e-139
Identity = 208/226 (92.04%), Postives = 216/226 (95.58%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLY ERVKHVE+QL+EVRGGRSQEYQGPLRRLQENMR+RIEVAGILK  R+ENIKHK+EAEEQAAHQH+KSEKWL YE +KEEI EKIRKLEEERHTVDLW  G EWGR+RRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLER D
Sbjct:    1 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYTERVKHVEFQLSEVRGGRSQEYQGPLRRLQENMRIRIEVAGILKGMRLENIKHKFEAEEQAAHQHFKSEKWLTYENMKEEILEKIRKLEEERHTVDLWSCGAEWGRKRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERTD 226          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|910318236|ref|XP_013161936.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein [Papilio xuthus])

HSP 1 Score: 387.882 bits (995), Expect = 3.512e-135
Identity = 205/226 (90.71%), Postives = 215/226 (95.13%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            MPSMKVEGDSDGDGD+SGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRR+ECLDNL+NLE QF++LREQLY ERVKHVEYQLAEVRGGRSQEY GPLRRLQENMRVRIEVAGILKQ RIENIKH Y+AEEQAAHQH+KSEKWLAYE LKEE+ EKIRK+EEERHTVDLW  G EWGR+RRKRQV VSPPYVVYMLPDADIMEDWRLVRKLLERAD
Sbjct:    1 MPSMKVEGDSDGDGDLSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRSECLDNLSNLEHQFSLLREQLYNERVKHVEYQLAEVRGGRSQEYLGPLRRLQENMRVRIEVAGILKQMRIENIKHIYDAEEQAAHQHFKSEKWLAYENLKEELLEKIRKIEEERHTVDLWSCGAEWGRKRRKRQVAVSPPYVVYMLPDADIMEDWRLVRKLLERAD 226          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|909562017|ref|XP_013136164.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein isoform X1 [Papilio polytes])

HSP 1 Score: 386.726 bits (992), Expect = 7.906e-135
Identity = 205/226 (90.71%), Postives = 214/226 (94.69%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNL+NLE QF++LREQLY ERVKHVEYQLAEVRGGRSQEY GPLRRLQENMRVRIEVAGILKQ RIEN+KH Y+AEEQAAHQH+KSEKWL YE LKEE+ EKIRK+EEERHTVDLW  G EWGR+RRKRQV VSPPYVVYMLPDADIMEDWRLVRKLLERAD
Sbjct:    1 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLSNLEHQFSLLREQLYNERVKHVEYQLAEVRGGRSQEYLGPLRRLQENMRVRIEVAGILKQMRIENMKHIYDAEEQAAHQHFKSEKWLVYENLKEELLEKIRKIEEERHTVDLWSCGAEWGRKRRKRQVAVSPPYVVYMLPDADIMEDWRLVRKLLERAD 226          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|1073524503|gb|JAT79363.1| (hypothetical protein g.16201, partial [Pectinophora gossypiella])

HSP 1 Score: 369.007 bits (946), Expect = 3.616e-128
Identity = 178/200 (89.00%), Postives = 189/200 (94.50%), Query Frame = 0
Query:   28 SSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            SSRGPDRDSSAEEADEPDSDDSSEMDE ECERRRNECLDNLANLERQFTVLREQLY ERVKHVEYQLAEVRGGRSQEY GPLR LQENMR+RIEVAG+LKQ RIENIKHKYEAEEQAAHQH+KSEKWL YE+++EE  EKIRKLEEER TVDLW +G EWG+RRRKRQVTV+PPYVVYMLPDADIMEDWRLVRKLLE++D
Sbjct:    1 SSRGPDRDSSAEEADEPDSDDSSEMDEGECERRRNECLDNLANLERQFTVLREQLYNERVKHVEYQLAEVRGGRSQEYLGPLRSLQENMRIRIEVAGVLKQMRIENIKHKYEAEEQAAHQHFKSEKWLTYESMREEFLEKIRKLEEERQTVDLWSTGAEWGKRRRKRQVTVTPPYVVYMLPDADIMEDWRLVRKLLEKSD 200          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|768431842|ref|XP_011557219.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein isoform X1 [Plutella xylostella] >gi|768431844|ref|XP_011557220.1| PREDICTED: breast cancer metastasis-suppressor 1-like protein isoform X2 [Plutella xylostella])

HSP 1 Score: 338.961 bits (868), Expect = 5.496e-116
Identity = 186/223 (83.41%), Postives = 206/223 (92.38%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLE 224
            MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECL+NLA+LE QF+VLREQLY ERV  VE+QL EVRGGRSQEY GPLRRLQENMRVRIEVAG+LKQ RI+NIKHK+EAEEQAAHQH+KSE+WL +E++KEEI EKIR+LEEER  V+LW S  +  RRRR+RQV VSPPYVVYMLPDADIM+DWRL+RKL++
Sbjct:    1 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLENLADLEHQFSVLREQLYRERVSRVEHQLGEVRGGRSQEYLGPLRRLQENMRVRIEVAGVLKQMRIDNIKHKFEAEEQAAHQHFKSERWLTFESIKEEILEKIRRLEEERQAVELWASDVDCPRRRRRRQVAVSPPYVVYMLPDADIMDDWRLIRKLID 223          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|1131321287|gb|JAV11002.1| (putative component of histone deacetyl [Nyssomyia neivai])

HSP 1 Score: 303.908 bits (777), Expect = 7.667e-102
Identity = 152/234 (64.96%), Postives = 191/234 (81.62%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRR---------RKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERA 226
            MPS+K EG+SDGDGDMSG ++E SG SSR PDRDSSAEEADEPDSDDSSEMDESECERRR++C+DNL +LERQF++LR+QL+ E+++ V+ QL+E+RGGRSQEY  PL+RL ENMR+R EVAGILKQYR+ENIK+K+ +EEQAA QHY+SEK LA + + EE+ EKIR+LEE+RH VD+  S  +WG  +         RK+ +TVS PY+VYML D DIMEDW  +RK L+R+
Sbjct:    1 MPSIKNEGESDGDGDMSGAESEHSG-SSRVPDRDSSAEEADEPDSDDSSEMDESECERRRSDCMDNLTHLERQFSILRDQLFREKIQQVDVQLSELRGGRSQEYLLPLQRLNENMRIRTEVAGILKQYRLENIKNKFASEEQAARQHYESEKHLAMDAIYEELMEKIRRLEEDRHNVDI--SWADWGTNQRTSKVRGPGRKKAITVSGPYIVYMLTDEDIMEDWTSIRKALKRS 231          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|943949002|ref|XP_014357542.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein [Papilio machaon])

HSP 1 Score: 289.271 bits (739), Expect = 7.304e-97
Identity = 142/167 (85.03%), Postives = 153/167 (91.62%), Query Frame = 0
Query:   61 RNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
            ++ C +N +NLE QF++LREQLY ERVKHVEYQLAEVRGGRSQEY GPLRRLQENMRVRIEVAGILKQ RIENIKH Y+AEEQAAHQH+KSEKWLAYE LKEE+ EKIRK+EEERHTVDLW  G EWGR+RRKRQV VSPPYVVYMLPDADIMEDWRLVRKLLERAD
Sbjct:   22 KSTCCEN-SNLEHQFSLLREQLYNERVKHVEYQLAEVRGGRSQEYLGPLRRLQENMRVRIEVAGILKQMRIENIKHIYDAEEQAAHQHFKSEKWLAYENLKEELLEKIRKIEEERHTVDLWSCGAEWGRKRRKRQVAVSPPYVVYMLPDADIMEDWRLVRKLLERAD 187          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|909562019|ref|XP_013136165.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein isoform X2 [Papilio polytes])

HSP 1 Score: 288.886 bits (738), Expect = 1.596e-96
Identity = 140/164 (85.37%), Postives = 148/164 (90.24%), Query Frame = 0
Query:   64 CLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERAD 227
             L  L NLE QF++LREQLY ERVKHVEYQLAEVRGGRSQEY GPLRRLQENMRVRIEVAGILKQ RIEN+KH Y+AEEQAAHQH+KSEKWL YE LKEE+ EKIRK+EEERHTVDLW  G EWGR+RRKRQV VSPPYVVYMLPDADIMEDWRLVRKLLERAD
Sbjct:   34 ILVALTNLEHQFSLLREQLYNERVKHVEYQLAEVRGGRSQEYLGPLRRLQENMRVRIEVAGILKQMRIENMKHIYDAEEQAAHQHFKSEKWLVYENLKEELLEKIRKIEEERHTVDLWSCGAEWGRKRRKRQVAVSPPYVVYMLPDADIMEDWRLVRKLLERAD 197          
BLAST of HiSeq13258 vs. genbank:protein
Match: gi|1121177635|ref|XP_019532875.1| (PREDICTED: breast cancer metastasis-suppressor 1-like protein [Aedes albopictus] >gi|1121185633|ref|XP_019535442.1| PREDICTED: breast cancer metastasis-suppressor 1-like protein [Aedes albopictus] >gi|604774535|gb|JAC09718.1| putative histone deacetylase complex protein [Aedes albopictus])

HSP 1 Score: 278.1 bits (710), Expect = 1.204e-91
Identity = 140/234 (59.83%), Postives = 179/234 (76.50%), Query Frame = 0
Query:    2 MPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSSEMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGGRSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYKSEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRR---------RKRQVTVSPPYVVYMLPDADIMEDWRLVRKLLERA 226
            MP +K EG+SD DGDMSG +++ S  SSR PD DSSAEEADEPDSDDSSEM E+ECERRR++CLDNL NLE+QF +L+EQLY E++  V+ QL E+RGGRSQEY  PL+RL +NM  R EVA ILK +RIENI+HK+E+E QA+ QH++SEK LA + ++EE+ EKIR+LEE+RH VD+  S  +WG            RK+ VTVS PY+VYML + DI+EDW  +RK L+R+
Sbjct:    1 MPPVKNEGESDADGDMSGAESDHSA-SSRAPDHDSSAEEADEPDSDDSSEMSETECERRRSDCLDNLTNLEKQFMILKEQLYKEKMHQVDQQLQEIRGGRSQEYLAPLQRLVDNMNSRKEVAEILKNFRIENIRHKFESELQASRQHFESEKQLAMDAIREELMEKIRRLEEDRHNVDI--SWADWGTSMRTSKVRGPGRKKAVTVSGPYIVYMLREEDILEDWTSIRKALKRS 231          
The following BLAST results are available for this feature:
BLAST of HiSeq13258 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|512914401|ref|XP_004928133.1|1.389e-14992.04PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|913322227|ref|XP_013192315.1|9.735e-13992.04PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|910318236|ref|XP_013161936.1|3.512e-13590.71PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|909562017|ref|XP_013136164.1|7.906e-13590.71PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|1073524503|gb|JAT79363.1|3.616e-12889.00hypothetical protein g.16201, partial [Pectinophor... [more]
gi|768431842|ref|XP_011557219.1|5.496e-11683.41PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|1131321287|gb|JAV11002.1|7.667e-10264.96putative component of histone deacetyl [Nyssomyia ... [more]
gi|943949002|ref|XP_014357542.1|7.304e-9785.03PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|909562019|ref|XP_013136165.1|1.596e-9685.37PREDICTED: breast cancer metastasis-suppressor 1-l... [more]
gi|1121177635|ref|XP_019532875.1|1.204e-9159.83PREDICTED: breast cancer metastasis-suppressor 1-l... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 54..82
NoneNo IPR availableCOILSCoilCoilcoord: 154..178
NoneNo IPR availablePANTHERPTHR21964BREAST CANCER METASTASIS-SUPPRESSOR 1coord: 2..223
IPR013907Sds3-likePFAMPF08598Sds3coord: 63..180
e-value: 1.4E-31
score: 109.5

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13258HiSeq13258Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13258_p ID=HiSeq13258_p|Name=HiSeq13258|organism=Ostrinia scapulalis|type=polypeptide|length=227bp
KMPSMKVEGDSDGDGDMSGGDTERSGGSSRGPDRDSSAEEADEPDSDDSS
EMDESECERRRNECLDNLANLERQFTVLREQLYCERVKHVEYQLAEVRGG
RSQEYQGPLRRLQENMRVRIEVAGILKQYRIENIKHKYEAEEQAAHQHYK
SEKWLAYETLKEEIQEKIRKLEEERHTVDLWPSGNEWGRRRRKRQVTVSP
PYVVYMLPDADIMEDWRLVRKLLERAD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013907Sds3