HiSeq13260_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13260
Unique NameHiSeq13260_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length78
Homology
BLAST of HiSeq13260 vs. genbank:protein
Match: gi|512910462|ref|XP_004927177.1| (PREDICTED: reticulon-4-interacting protein 1, mitochondrial [Bombyx mori])

HSP 1 Score: 97.8265 bits (242), Expect = 1.776e-22
Identity = 42/64 (65.62%), Postives = 51/64 (79.69%), Query Frame = 0
Query:   13 PHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWWRAREAFERAARGSARGKLLLDFRAQP 76
            PHVRWAYF PNADDIE LR+L+E G++ V VE+ + WW    A+ER ARGSARGKL+LDF+A P
Sbjct:  315 PHVRWAYFMPNADDIEMLRRLSESGEYTVAVEQVYPWWEGLAAYERMARGSARGKLILDFKAPP 378          
BLAST of HiSeq13260 vs. genbank:protein
Match: gi|357631289|gb|EHJ78878.1| (hypothetical protein KGM_10315 [Danaus plexippus])

HSP 1 Score: 95.9005 bits (237), Expect = 8.089e-22
Identity = 43/70 (61.43%), Postives = 53/70 (75.71%), Query Frame = 0
Query:    3 RAGGGAGACPPHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWWRAREAFERAARGSARGKLLLDF 72
            R+     +CPPHVRWA+FAP++DDIE LR+LAE+G+  V VE  F WW    A+ERAARG ARGKL+LDF
Sbjct:  284 RSAPAPSSCPPHVRWAFFAPSSDDIETLRRLAERGRLSVCVERVFPWWEGVAAYERAARGGARGKLVLDF 353          
BLAST of HiSeq13260 vs. genbank:protein
Match: gi|910341836|ref|XP_013174645.1| (PREDICTED: reticulon-4-interacting protein 1 homolog, mitochondrial-like, partial [Papilio xuthus])

HSP 1 Score: 88.1965 bits (217), Expect = 3.509e-20
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 0
Query:   11 CPPHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWWRAREAFERAARGSARGKLLL 70
            CPPHVRWA+F+P+A D++ LR+LA+ GKF V VE  F WW  REA+ERAA G ARGKLLL
Sbjct:  118 CPPHVRWAFFSPSAHDLQLLRRLADAGKFTVAVERVFPWWAGREAYERAAEGGARGKLLL 177          
BLAST of HiSeq13260 vs. genbank:protein
Match: gi|930660211|gb|KPJ02206.1| (Reticulon-4-interacting protein 1-like, mitochondrial [Papilio xuthus])

HSP 1 Score: 89.3521 bits (220), Expect = 3.522e-19
Identity = 40/62 (64.52%), Postives = 48/62 (77.42%), Query Frame = 0
Query:   11 CPPHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWWRAREAFERAARGSARGKLLLDF 72
            CPPHVRWA+F+P+A D++ LR+LA+ GKF V VE  F WW  REA+ERAA G ARGKLLL  
Sbjct:  340 CPPHVRWAFFSPSAHDLQLLRRLADAGKFSVAVERVFPWWAGREAYERAAEGGARGKLLLHM 401          
BLAST of HiSeq13260 vs. genbank:protein
Match: gi|909558946|ref|XP_013134500.1| (PREDICTED: reticulon-4-interacting protein 1 homolog, mitochondrial-like, partial [Papilio polytes])

HSP 1 Score: 67.0106 bits (162), Expect = 1.871e-11
Identity = 39/60 (65.00%), Postives = 46/60 (76.67%), Query Frame = 0
Query:   11 CPPHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWWRAREAFERAARGSARGKLLL 70
            CPPHVRWA+FAP+A D++ LR+LA+ GKF V VE  F WW  R A+ RAA G ARGKLLL
Sbjct:  204 CPPHVRWAFFAPSAHDLQLLRRLADAGKFSVAVERVFPWWEGRAAYARAAAGGARGKLLL 263          
The following BLAST results are available for this feature:
BLAST of HiSeq13260 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 5
Match NameE-valueIdentityDescription
gi|512910462|ref|XP_004927177.1|1.776e-2265.63PREDICTED: reticulon-4-interacting protein 1, mito... [more]
gi|357631289|gb|EHJ78878.1|8.089e-2261.43hypothetical protein KGM_10315 [Danaus plexippus][more]
gi|910341836|ref|XP_013174645.1|3.509e-2066.67PREDICTED: reticulon-4-interacting protein 1 homol... [more]
gi|930660211|gb|KPJ02206.1|3.522e-1964.52Reticulon-4-interacting protein 1-like, mitochondr... [more]
gi|909558946|ref|XP_013134500.1|1.871e-1165.00PREDICTED: reticulon-4-interacting protein 1 homol... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13602ADH_zinc_N_2coord: 21..70
e-value: 1.6E-8
score: 35.3

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13260HiSeq13260Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13260_p ID=HiSeq13260_p|Name=HiSeq13260|organism=Ostrinia scapulalis|type=polypeptide|length=78bp
GGRAGGGAGACPPHVRWAYFAPNADDIEHLRKLAEQGKFCVQVEETFEWW
RAREAFERAARGSARGKLLLDFRAQPRH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO:0008270zinc ion binding