HiSeq13275_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13275
Unique NameHiSeq13275_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length385
Homology
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|910330731|ref|XP_013168673.1| (PREDICTED: uncharacterized protein LOC106118554 [Papilio xuthus] >gi|930655398|gb|KPI97728.1| hypothetical protein RR46_02403 [Papilio xuthus])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 246/381 (64.57%), Postives = 306/381 (80.31%), Query Frame = 0
Query:    4 SWLLITVLAAVAVADDSSEDVLSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            +++L++VL  +A+A++       LAE C++E C+LP+CRCSST+IPG+L PR TPQFVM+TFDD VNI NIETYR+++Y RTN N C A  TF+V+HEYT+YQ VNELYN+G+EIALHSITH+T Q YW  AT EDMMKEFGDQ++QM   ANIP   I GIR PFLQ++GNA+FQV+  TGL YD +WPT  F +PGLWPYTLDYASTQDC++PPCPTAS+PG WV+PM+SW DL G  CSM D+C F P   DE+AWF+FI+ NFERHYLGNRAPFG++VHEWY+ AYP V+RA+ RFLD++N++ D FMV+  EV++WV+NP+PVNEY  K CK  V T+C  + CGPLSS HTEM YWM +C+SCP  YPWLGNPLG
Sbjct:    5 TFILLSVLIGLAIAEEPEA---PLAEECNKELCKLPKCRCSSTDIPGDLAPRDTPQFVMLTFDDGVNIRNIETYREIIYRRTNKNNCPASVTFFVNHEYTDYQRVNELYNQGFEIALHSITHQTPQSYWSEATYEDMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAATGLRYDSTWPTTGFTDPGLWPYTLDYASTQDCIIPPCPTASVPGVWVLPMISWTDLNGFPCSMVDACVFVPPHHDEEAWFKFILTNFERHYLGNRAPFGFYVHEWYIAAYPGVKRALVRFLDLVNSLNDAFMVSAGEVIDWVENPVPVNEYVKKECKRFVPTSCRATSCGPLSSTHTEMTYWMQICNSCPRVYPWLGNPLG 382          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|909558149|ref|XP_013134076.1| (PREDICTED: uncharacterized protein LOC106099929 [Papilio polytes])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 248/381 (65.09%), Postives = 302/381 (79.27%), Query Frame = 0
Query:    4 SWLLITVLAAVAVADDSSEDVLSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            ++LL++VL  +AVA    E    LAE CD+E C+LP+CRCSST+IPG+L  R TPQFV++TFDD VNI NIETYR++LY RTN N C A  TF+V+HEYT+YQ VNELYN+G+EIALHSITH+T Q YW  AT EDMMKEFGDQ++QM   ANIP   I GIR PFLQ++GNA+FQV+ ETGL YD +WPT  F +PG WPYTLDYASTQDCV+PPCPTAS+PG WV+PM+SW DL G  CSM D+C F P   DE AWF+FI+ NFERHYLGNRAPFG++VHEWY+ AYP V+RA+ RFLD+IN++ D FMV+  EV++WV+NP+PVNEY  K CK+   T C  + CGPL+S HTEM YWM +C++CP  YPWLGNPLG
Sbjct:    5 TFLLLSVLIGLAVA---EEPEAPLAEECDKELCELPKCRCSSTDIPGDLAARDTPQFVLLTFDDGVNIRNIETYREILYRRTNKNNCPASVTFFVNHEYTDYQRVNELYNQGFEIALHSITHQTPQSYWAEATYEDMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAETGLRYDSTWPTTRFTDPGKWPYTLDYASTQDCVIPPCPTASVPGVWVLPMISWTDLNGFPCSMVDACVFVPPHHDEDAWFKFILTNFERHYLGNRAPFGFYVHEWYISAYPGVKRALIRFLDLINSLNDTFMVSAGEVIDWVENPVPVNEYVKKECKSFTPTNCRATSCGPLTSTHTEMSYWMQICNTCPRVYPWLGNPLG 382          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|943966544|ref|XP_014365314.1| (PREDICTED: uncharacterized protein LOC106716323 [Papilio machaon] >gi|930668954|gb|KPJ09940.1| hypothetical protein RR48_02918 [Papilio machaon])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 243/381 (63.78%), Postives = 306/381 (80.31%), Query Frame = 0
Query:    4 SWLLITVLAAVAVADDSSEDVLSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            +++L++VL  +AVA++       LAE C++E C+LP+CRCSST+IPG L PR TPQF+ +TFDD VNI NIETYR++LY RTN N C A  TF+V+HEYT+YQLVNELYN+G+EIALHSI+H+T Q YW  AT E+MMKEFGDQ++QM   ANIP   I GIR PFLQ++GNA+FQV+  TGL YD +WPT SF +PGLWPYTLDYASTQDC+VPPCPTAS+PG WV+PM+SW DL G  CSM D+C F P   DE+AWF+FI+ NFERHYLGNRAPFG+++HEWY+ AYP V+RA+ RFLD++N++ D FMV+  EV++WV+NP+PVNEY  K CK+ V+T+C  + CGPL+S HTEM YWM +C+ CP  YPWL NPLG
Sbjct:    5 TFILLSVLIGLAVAEEPEA---PLAEECNKELCKLPKCRCSSTDIPGELAPRDTPQFITLTFDDGVNIRNIETYREILYQRTNKNNCPASATFFVNHEYTDYQLVNELYNQGFEIALHSISHQTPQSYWTEATYENMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAATGLRYDSTWPTTSFTDPGLWPYTLDYASTQDCIVPPCPTASVPGVWVLPMISWRDLNGFPCSMVDACVFVPPHHDEEAWFKFILTNFERHYLGNRAPFGFYIHEWYISAYPGVKRALVRFLDLVNSLNDAFMVSAGEVIDWVENPVPVNEYVKKECKSFVSTSCRRTSCGPLTSTHTEMSYWMQICNICPRVYPWLENPLG 382          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|283826821|gb|ADB43612.1| (chitin deacetylase 5b [Helicoverpa armigera])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 237/361 (65.65%), Postives = 289/361 (80.06%), Query Frame = 0
Query:   25 LSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLGL 385
            L LAE CD+E C+LP+CRCSST IPG L PR TPQFV VTFDD VN+INI TYR++L GR N+NGC AG TFYVSHEYTNY++VNELYN GYEIALHSI+HK  Q++W TAT +++ +E  DQR QM   ANIP   I G+R PFLQL+GN +FQV+ +  L YDCSWPT +F +PGLWPYTLDYAS QDC++PPCPTASIP  WV+PMVSW DL    C+MADSCF+TP + DE+AWF+FIV NFERHYLGNRAPFG++VHEWYL A PAV+ A  RFL++IN++PDVFMVN++EV++WVKNP+P+ EY +K C+T  +  CPVS+CG + S H +M YW+  C+ CP  YPW GNPLGL
Sbjct:   34 LPLAEECDEELCKLPDCRCSSTEIPGGLLPRDTPQFVTVTFDDGVNVININTYREVLDGRQNSNGCPAGATFYVSHEYTNYRIVNELYNNGYEIALHSISHKIPQDWWATATYDELKEEIADQRTQMAHFANIPFESIKGVRLPFLQLAGNTSFQVMADHDLLYDCSWPTNTFTDPGLWPYTLDYASEQDCMIPPCPTASIPKPWVLPMVSWKDLNDFPCAMADSCFYTPDMEDEEAWFQFIVSNFERHYLGNRAPFGFYVHEWYLSANPAVKSAFIRFLNLINSLPDVFMVNSSEVIDWVKNPVPLTEYRAKPCRTWSSAACPVSLCGNVPSEHNQMTYWLEACNVCPRVYPWTGNPLGL 394          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|171740881|gb|ACB54935.1| (chitin deacetylase, partial [Helicoverpa armigera])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 237/361 (65.65%), Postives = 289/361 (80.06%), Query Frame = 0
Query:   25 LSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLGL 385
            L LAE CD+E C+LP+CRCSST IPG L PR TPQFV VTFDD VN+INI TYR++L GR N+NGC AG TFYVSHEYTNY++VNELYN GYEIALHSI+HK  Q++W TAT +++ +E  DQR QM   ANIP   I G+R PFLQL+GN +FQV+ +  L YDCSWPT +F +PGLWPYTLDYAS QDC++PPCPTASIP  WV+PMVSW DL    C+MADSCF+TP + DE+AWF+FIV NFERHYLGNRAPFG++VHEWYL A PAV+ A  RFL++IN++PDVFMVN++EV++WVKNP+P+ EY +K C+T  +  CPVS+CG + S H +M YW+  C+ CP  YPW GNPLGL
Sbjct:   30 LPLAEECDEELCKLPDCRCSSTEIPGGLLPRDTPQFVTVTFDDGVNVININTYREVLDGRQNSNGCPAGATFYVSHEYTNYRIVNELYNNGYEIALHSISHKIPQDWWATATYDELKEEIADQRTQMAHFANIPFESIKGVRLPFLQLAGNTSFQVMADHDLLYDCSWPTNTFTDPGLWPYTLDYASEQDCMIPPCPTASIPKPWVLPMVSWKDLNDFPCAMADSCFYTPDMEDEEAWFQFIVSNFERHYLGNRAPFGFYVHEWYLSANPAVKSAFIRFLNLINSLPDVFMVNSSEVIDWVKNPVPLTEYRAKPCRTWSSAACPVSLCGNVPSEHNQMTYWLEACNVCPRVYPWTGNPLGL 390          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|1073537557|gb|JAT85890.1| (hypothetical protein g.8615 [Pectinophora gossypiella])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 240/385 (62.34%), Postives = 293/385 (76.10%), Query Frame = 0
Query:    1 MKWSWLLITVLAAVAVADDSSEDVLSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLGL 385
            MKW  LL  +  A+ VA++  E  L LAESC+ E+CQLP+CRCSST+ PG L  R  PQFV VTFDD VNI+NIETYR +LYGR N+N C AG TFY++HEYTNYQLVNELYN G+EIALHSI+H+T+QEYW  AT EDM++EF DQ+ QM   ANIP SEI GIR PFLQL+GN++F VI E G  YD SWPT+ FV  GLWPY+LDY+S QDCV+ PCPTASIP AWV PM+SW DL G  C+M DSCF  P   DE+AWF FI+ NFERHYL +RAPFG++VHEWYL  YPA+  A+ RF++++N + D FMV  +EV++WV++PIPVNEY  K CK+     C  + CGPL + H  + YWM +C++CP TYPWLGNPLGL
Sbjct:    1 MKWFTLLSLLFVALVVAEE--ERNLPLAESCNLESCQLPDCRCSSTSTPGGLPLRDVPQFVTVTFDDGVNILNIETYRKILYGRRNSNQCPAGATFYINHEYTNYQLVNELYNNGFEIALHSISHQTNQEYWSQATYEDMVREFADQKTQMSHFANIPRSEIKGIRMPFLQLAGNSSFLVIAEHGFLYDSSWPTVQFVGSGLWPYSLDYSSIQDCVISPCPTASIPKAWVSPMISWLDLNGSPCAMVDSCFAFPDREDEEAWFRFILTNFERHYLNSRAPFGFYVHEWYLSTYPAIMNALVRFMNLVNELEDTFMVTESEVIDWVRDPIPVNEYKEKPCKSFAPMPCAATSCGPLRAEHNNLDYWMAICNTCPRTYPWLGNPLGL 383          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|910330741|ref|XP_013168678.1| (PREDICTED: uncharacterized protein LOC106118559 [Papilio xuthus] >gi|930655397|gb|KPI97727.1| hypothetical protein RR46_02402 [Papilio xuthus])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 236/360 (65.56%), Postives = 286/360 (79.44%), Query Frame = 0
Query:   25 LSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            L LA  CD+  C LP CRCSSTN+PG L PR  PQFV VTFDDAVN+INIETYR++LYGR+N+NGC AG TFYVSHEYTNY LVNELYNRGYE++LHS+TH+T Q YW  A  + ++KE  DQ++QM   A IP  EI G+R PFLQ+SGNA+FQV+ ++GL YD SWPT+S VNPGLWPYTLDYAS QDCVVPPCP+ASIPG WV+PM+SW+DL G  CSMADSCFFTP L DE AW+ FI+ NFERHY GNRAPFG+++HEWYL   PAV+ A  RF++ +NN+ D FMVN N+++EWV+NPIPV+EY  + C+   +T C ++ CGPL S H  + YWM VC++CP  YPWLGNPLG
Sbjct:   18 LPLATECDETKCLLPRCRCSSTNVPGGLAPRDVPQFVSVTFDDAVNVINIETYREILYGRSNSNGCPAGATFYVSHEYTNYVLVNELYNRGYEVSLHSMTHQTPQTYWAEADYDVLVKELADQKRQMSHFALIPEQEIRGVRLPFLQMSGNASFQVMADSGLVYDNSWPTVSHVNPGLWPYTLDYASIQDCVVPPCPSASIPGPWVMPMISWSDLNGSPCSMADSCFFTPPLDDENAWYNFILTNFERHYRGNRAPFGFYIHEWYLAVNPAVKAAFVRFMNYVNNLNDAFMVNANQIIEWVQNPIPVSEYIRRPCRRFSSTPCRMTGCGPLRSEHNGLDYWMQVCNTCPRVYPWLGNPLG 377          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|512894542|ref|XP_004923455.1| (PREDICTED: uncharacterized protein LOC101735686 [Bombyx mori])

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 227/360 (63.06%), Postives = 289/360 (80.28%), Query Frame = 0
Query:   25 LSLAESCDQEACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            L LA  CD+EAC+LP+CRCSSTNIPG L  R TPQFV VTFDD +N+INIETYR++LYGR+N+N C AG TFYVSHEYTNYQLVNELYNRG+EIALHSI+H+T Q +W  AT +++++E GDQ++QM   A+IP S I G+R PFLQ+SGN +FQV+ +  L YDC+WPT +  NPGLWPYTL + S QDC++PPCPTASIPG WV+PM+SW DL    CSM D CFFTP  TDE+ WF+FI+ NFERHYLGNRAPFG+FVHEW++ + PA++RA  RF+D+INN+ DVFMVN+ EV++WVKNP+P++ Y  + CK  + + C  S CGPL+  H ++ Y+MT+C++CP  YPW+GNPLG
Sbjct:   21 LPLATPCDEEACKLPDCRCSSTNIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRSNSNRCPAGATFYVSHEYTNYQLVNELYNRGFEIALHSISHRTPQAFWADATYQNLVQEIGDQKRQMAHFASIPASAIKGVRIPFLQMSGNTSFQVMADFDLLYDCTWPTTALTNPGLWPYTLHHESIQDCIIPPCPTASIPGPWVLPMISWRDLNNFPCSMVDGCFFTPDRTDEEGWFKFILTNFERHYLGNRAPFGFFVHEWFISSNPAIKRAFVRFMDIINNLNDVFMVNSAEVIDWVKNPVPIDRYRQQQCKFTMPSICRPSFCGPLTGTHNQLSYYMTICNTCPRNYPWVGNPLG 380          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|187884602|gb|ACD37362.1| (chitin deacetylase 1 [Mamestra configurata])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 237/371 (63.88%), Postives = 289/371 (77.90%), Query Frame = 0
Query:   18 DDSS---EDVLSLAESCDQE-ACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            DDSS   E  L  AE C  E  C+LP CRCSSTNIPG L+P+ TPQFV VTFDD +N+ NI TYR+ LY R N+NGC AG TFYVSHEYTNY +VNELYN+G+EIALHSI+H+T Q YW  AT +DM +EFGDQ+ Q+   ANIP   I G+R PFLQ++GNA+F+++KE GL YDC+WPT S  NPGLWPYTLDYASTQDC+VPPCPTAS PG WV P+V+W+DLQGVACS  D+CFF P   DE AW++FI+ NFERHYLGNRAPFG+FVHE +L A+PAV+ A  RFLD+INN+PD FMVN++EV++WVKNP+P+++Y ++ C+      C    CGPL+S H  M YWM +C+ CP  YPWLGNPLG
Sbjct:   19 DDSSSKEEAGLKEAEECTPETVCELPNCRCSSTNIPGGLQPKDTPQFVTVTFDDGINVNNILTYRNTLYNRRNSNGCPAGATFYVSHEYTNYVIVNELYNQGFEIALHSISHQTPQTYWFEATKDDMKREFGDQKIQIAHFANIPYESIKGLRIPFLQMTGNASFEIMKEYGLEYDCTWPTTSHTNPGLWPYTLDYASTQDCIVPPCPTASFPGTWVKPLVTWSDLQGVACSFVDACFFIPDRADEDAWYKFILTNFERHYLGNRAPFGFFVHEAFLSAFPAVRGAFVRFLDLINNLPDTFMVNSHEVIDWVKNPVPIDKYKAQGCRRFNPRACVARSCGPLNSGHNGMDYWMQICNVCPRVYPWLGNPLG 389          
BLAST of HiSeq13275 vs. genbank:protein
Match: gi|336289020|gb|AEI30869.1| (chitin deacetylase 2 [Mamestra brassicae])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 239/371 (64.42%), Postives = 288/371 (77.63%), Query Frame = 0
Query:   18 DDSS---EDVLSLAESCDQE-ACQLPECRCSSTNIPGNLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSHEYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQMELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNPGLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSCFFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAVARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVSVCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLG 384
            DDSS   E  L  AE C  +  C+LP CRCSSTNIPG L+PR TPQFV VTFDD +NI NI TYR+ LY R N++GC AG TFYVSHEYTNY +VNELYN+G+EIALHSITH+T Q YW  AT EDM +EFGDQ+ QM   ANIP   I G+R PFLQ++GNA+F+++KE GL YDC+WPT S  NPGLWPYTLDYASTQDC+VPPCPTAS PG WV P+V+W+DLQGVACS  D+CFF P   DE AW++FI+ NFERHYLGNRAPFG+FVHE +L A+PAV+ A  RFLD+INN+PD FMVN++EV++WVKN +P+++Y ++ C+      C    CGPL+S H  M YWM +C+ CP  YPWLGNPLG
Sbjct:   19 DDSSSEEEAGLKEAEECTPDTVCELPNCRCSSTNIPGGLQPRDTPQFVTVTFDDGININNILTYRNTLYNRRNSSGCPAGATFYVSHEYTNYVIVNELYNQGFEIALHSITHQTPQTYWFEATKEDMKREFGDQKIQMAHFANIPYESIKGLRIPFLQMTGNASFEIMKEYGLEYDCTWPTTSHTNPGLWPYTLDYASTQDCIVPPCPTASFPGTWVKPLVTWSDLQGVACSFVDACFFIPDRADEDAWYKFILTNFERHYLGNRAPFGFFVHEAFLSAFPAVRGAFVRFLDLINNLPDTFMVNSHEVIDWVKNSVPIDKYKAQGCRRFNPRACVARSCGPLNSSHNGMDYWMQICNVCPRVYPWLGNPLG 389          
The following BLAST results are available for this feature:
BLAST of HiSeq13275 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910330731|ref|XP_013168673.1|0.000e+064.57PREDICTED: uncharacterized protein LOC106118554 [P... [more]
gi|909558149|ref|XP_013134076.1|0.000e+065.09PREDICTED: uncharacterized protein LOC106099929 [P... [more]
gi|943966544|ref|XP_014365314.1|0.000e+063.78PREDICTED: uncharacterized protein LOC106716323 [P... [more]
gi|283826821|gb|ADB43612.1|0.000e+065.65chitin deacetylase 5b [Helicoverpa armigera][more]
gi|171740881|gb|ACB54935.1|0.000e+065.65chitin deacetylase, partial [Helicoverpa armigera][more]
gi|1073537557|gb|JAT85890.1|0.000e+062.34hypothetical protein g.8615 [Pectinophora gossypie... [more]
gi|910330741|ref|XP_013168678.1|0.000e+065.56PREDICTED: uncharacterized protein LOC106118559 [P... [more]
gi|512894542|ref|XP_004923455.1|0.000e+063.06PREDICTED: uncharacterized protein LOC101735686 [B... [more]
gi|187884602|gb|ACD37362.1|0.000e+063.88chitin deacetylase 1 [Mamestra configurata][more]
gi|336289020|gb|AEI30869.1|0.000e+064.42chitin deacetylase 2 [Mamestra brassicae][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
molecular_function GO:0016798 hydrolase activity, acting on glycosyl bonds
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002509Polysaccharide deacetylaseGENE3D3.20.20.370coord: 56..331
e-value: 1.1E-15
score: 57.1
IPR002509Polysaccharide deacetylasePFAMPF01522Polysacc_deac_1coord: 56..189
e-value: 2.5E-7
score: 30.2
NoneNo IPR availablePANTHERPTHR11177CHITINASEcoord: 29..384
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 18..385
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..12
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..17
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 13..17
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.787
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..17
score: 0.577
IPR011330Glycoside hydrolase/deacetylase, beta/alpha-barrelSUPERFAMILY88713Glycoside hydrolase/deacetylasecoord: 27..331

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13275HiSeq13275Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13275_p ID=HiSeq13275_p|Name=HiSeq13275|organism=Ostrinia scapulalis|type=polypeptide|length=385bp
MKWSWLLITVLAAVAVADDSSEDVLSLAESCDQEACQLPECRCSSTNIPG
NLEPRSTPQFVMVTFDDAVNIINIETYRDLLYGRTNANGCSAGGTFYVSH
EYTNYQLVNELYNRGYEIALHSITHKTDQEYWRTATTEDMMKEFGDQRKQ
MELLANIPISEIHGIRSPFLQLSGNATFQVIKETGLTYDCSWPTISFVNP
GLWPYTLDYASTQDCVVPPCPTASIPGAWVVPMVSWNDLQGVACSMADSC
FFTPSLTDEQAWFEFIVGNFERHYLGNRAPFGYFVHEWYLRAYPAVQRAV
ARFLDMINNIPDVFMVNTNEVVEWVKNPIPVNEYSSKACKTPVATTCPVS
VCGPLSSHHTEMQYWMTVCSSCPNTYPWLGNPLGL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0003824catalytic activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR011330Glyco_hydro/deAcase_b/a-brl
IPR002509Polysac_deacetylase