HiSeq13276_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13276
Unique NameHiSeq13276_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length383
Homology
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|909558149|ref|XP_013134076.1| (PREDICTED: uncharacterized protein LOC106099929 [Papilio polytes])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 251/378 (66.40%), Postives = 301/378 (79.63%), Query Frame = 0
Query:    5 SWILLLAAVALAQNSEEELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            +++LL   + LA   E E  LAE CD + C+LP+CRC+STDIPG+LA RDTPQFV++TFDD VN+ NIETYRE+LY R N N CP   TF+VNHEYT+YQ VNELYNQGFEIALHSI+H+TPQ++W EA  EDM +EFGDQ  QM+ FANIP DAI GIR PFLQ++GNA+FQV+ ET L YD +WPT    DPG WPYTLDYASTQDCVIPPCPTA++PGVWV+PM+SW DL G PC+M D+C F PP +DEDAWF+FI  NFE HY GNR+PFGF+VHEWY+ A P V+RALIRFLD+IN++ D FMV+  +V+DWV+NPVPVNEY +K C    PT CR   CGPLT+ HTEM YWM +C+ CP  YPW+GNPLG
Sbjct:    5 TFLLLSVLIGLAVAEEPEAPLAEECDKELCELPKCRCSSTDIPGDLAARDTPQFVLLTFDDGVNIRNIETYREILYRRTNKNNCPASVTFFVNHEYTDYQRVNELYNQGFEIALHSITHQTPQSYWAEATYEDMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAETGLRYDSTWPTTRFTDPGKWPYTLDYASTQDCVIPPCPTASVPGVWVLPMISWTDLNGFPCSMVDACVFVPPHHDEDAWFKFILTNFERHYLGNRAPFGFYVHEWYISAYPGVKRALIRFLDLINSLNDTFMVSAGEVIDWVENPVPVNEYVKKECKSFTPTNCRATSCGPLTSTHTEMSYWMQICNTCPRVYPWLGNPLG 382          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|910330731|ref|XP_013168673.1| (PREDICTED: uncharacterized protein LOC106118554 [Papilio xuthus] >gi|930655398|gb|KPI97728.1| hypothetical protein RR46_02403 [Papilio xuthus])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 247/378 (65.34%), Postives = 303/378 (80.16%), Query Frame = 0
Query:    5 SWILLLAAVALAQNSEEELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            ++ILL   + LA   E E  LAE C+ + C+LP+CRC+STDIPG+LAPRDTPQFVM+TFDD VN+ NIETYRE++Y R N N CP   TF+VNHEYT+YQ VNELYNQGFEIALHSI+H+TPQ++W EA  EDM +EFGDQ  QM+ FANIP DAI GIR PFLQ++GNA+FQV+  T L YD +WPT    DPGLWPYTLDYASTQDC+IPPCPTA++PGVWV+PM+SW DL G PC+M D+C F PP +DE+AWF+FI  NFE HY GNR+PFGF+VHEWY+ A P V+RAL+RFLD++N++ D FMV+  +V+DWV+NPVPVNEY +K C    PT+CR   CGPL++ HTEM YWM +C+ CP  YPW+GNPLG
Sbjct:    5 TFILLSVLIGLAIAEEPEAPLAEECNKELCKLPKCRCSSTDIPGDLAPRDTPQFVMLTFDDGVNIRNIETYREIIYRRTNKNNCPASVTFFVNHEYTDYQRVNELYNQGFEIALHSITHQTPQSYWSEATYEDMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAATGLRYDSTWPTTGFTDPGLWPYTLDYASTQDCIIPPCPTASVPGVWVLPMISWTDLNGFPCSMVDACVFVPPHHDEEAWFKFILTNFERHYLGNRAPFGFYVHEWYIAAYPGVKRALVRFLDLVNSLNDAFMVSAGEVIDWVENPVPVNEYVKKECKRFVPTSCRATSCGPLSSTHTEMTYWMQICNSCPRVYPWLGNPLG 382          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|943966544|ref|XP_014365314.1| (PREDICTED: uncharacterized protein LOC106716323 [Papilio machaon] >gi|930668954|gb|KPJ09940.1| hypothetical protein RR48_02918 [Papilio machaon])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 244/378 (64.55%), Postives = 303/378 (80.16%), Query Frame = 0
Query:    5 SWILLLAAVALAQNSEEELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            ++ILL   + LA   E E  LAE C+ + C+LP+CRC+STDIPG LAPRDTPQF+ +TFDD VN+ NIETYRE+LY R N N CP   TF+VNHEYT+YQ+VNELYNQGFEIALHSISH+TPQ++W EA  E+M +EFGDQ  QM+ FANIP DAI GIR PFLQ++GNA+FQV+  T L YD +WPT +  DPGLWPYTLDYASTQDC++PPCPTA++PGVWV+PM+SWRDL G PC+M D+C F PP +DE+AWF+FI  NFE HY GNR+PFGF++HEWY+ A P V+RAL+RFLD++N++ D FMV+  +V+DWV+NPVPVNEY +K C     T+CR+  CGPLT+ HTEM YWM +C+ CP  YPW+ NPLG
Sbjct:    5 TFILLSVLIGLAVAEEPEAPLAEECNKELCKLPKCRCSSTDIPGELAPRDTPQFITLTFDDGVNIRNIETYREILYQRTNKNNCPASATFFVNHEYTDYQLVNELYNQGFEIALHSISHQTPQSYWTEATYENMMKEFGDQKRQMSHFANIPSDAIQGIRIPFLQMTGNASFQVMAATGLRYDSTWPTTSFTDPGLWPYTLDYASTQDCIVPPCPTASVPGVWVLPMISWRDLNGFPCSMVDACVFVPPHHDEEAWFKFILTNFERHYLGNRAPFGFYIHEWYISAYPGVKRALVRFLDLVNSLNDAFMVSAGEVIDWVENPVPVNEYVKKECKSFVSTSCRRTSCGPLTSTHTEMSYWMQICNICPRVYPWLENPLG 382          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|512894542|ref|XP_004923455.1| (PREDICTED: uncharacterized protein LOC101735686 [Bombyx mori])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 232/361 (64.27%), Postives = 287/361 (79.50%), Query Frame = 0
Query:   22 ELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            EL LA PCD + C+LP+CRC+ST+IPG L  RDTPQFV VTFDD +NVINIETYREVLY R NSN CP G TFYV+HEYTNYQ+VNELYN+GFEIALHSISHRTPQ +W +A  +++ QE GDQ  QMA FA+IP  AI G+R PFLQ+SGN +FQV+ +  L YDC+WPT    +PGLWPYTL + S QDC+IPPCPTA++PG WV+PM+SWRDL   PC+M D CFFTP   DE+ WF+FI  NFE HY GNR+PFGFFVHEW++ +NPA++RA +RF+D+INN+ DVFMVN+ +V+DWVKNPVP++ Y Q+ C    P+ CR + CGPLT  H ++ Y+M +C+ CP NYPW+GNPLG
Sbjct:   20 ELPLATPCDEEACKLPDCRCSSTNIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRSNSNRCPAGATFYVSHEYTNYQLVNELYNRGFEIALHSISHRTPQAFWADATYQNLVQEIGDQKRQMAHFASIPASAIKGVRIPFLQMSGNTSFQVMADFDLLYDCTWPTTALTNPGLWPYTLHHESIQDCIIPPCPTASIPGPWVLPMISWRDLNNFPCSMVDGCFFTPDRTDEEGWFKFILTNFERHYLGNRAPFGFFVHEWFISSNPAIKRAFVRFMDIINNLNDVFMVNSAEVIDWVKNPVPIDRYRQQQCKFTMPSICRPSFCGPLTGTHNQLSYYMTICNTCPRNYPWVGNPLG 380          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|913312134|ref|XP_013186778.1| (PREDICTED: uncharacterized protein LOC106132023 [Amyelois transitella])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 245/384 (63.80%), Postives = 307/384 (79.95%), Query Frame = 0
Query:    2 MRWSWILL-LAAVALAQNSEEELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVR--ANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            MR + +L+ L  + +AQ      +LAEPCD + C+LP+CRC+ST IPG LA RDTPQFV++TFDDAVN+INIETYR+V+Y+RRNSN CP G TFYVNHEYT+YQ+VNELYN GFEIALHS+SH T QT+W EA  +DM QE G+Q+ QM+ FANIP D+I G+R PFLQ++GNA+FQV+ + +L YDCSWPT++ ++PGLWPYTLDYASTQDC+IPPCPTA++PGVWV+PMV+WRDL   PC+M DSC   P  + E+ WFQ I  NFE HYFGNR+PFGF++HEWY+R   NP V RAL RFLD+INN+ DVFMVN+++V+DWVKNPVPVNEY+Q+ C    PT C  A C P+ A+H    YWM++C+ CP  YPW+GNPLG
Sbjct:    1 MRSAIVLVSLFVLTVAQ------ELAEPCDEEACKLPDCRCSSTSIPGGLAARDTPQFVLLTFDDAVNIINIETYRDVIYNRRNSNSCPAGVTFYVNHEYTDYQLVNELYNHGFEIALHSVSHMTNQTYWQEASYDDMVQELGEQVVQMSHFANIPTDSIKGVRLPFLQMTGNASFQVMADYNLEYDCSWPTVSQINPGLWPYTLDYASTQDCIIPPCPTASVPGVWVLPMVTWRDLNNNPCSMVDSCLAVP--STEEEWFQLILSNFERHYFGNRAPFGFYIHEWYIRENVNPHVGRALKRFLDLINNLYDVFMVNSQEVIDWVKNPVPVNEYAQQPCRTYVPTMCAPATC-PVAAEHNLNVYWMSICNVCPRVYPWLGNPLG 375          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|913311973|ref|XP_013186691.1| (PREDICTED: uncharacterized protein LOC106131956 [Amyelois transitella])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 239/366 (65.30%), Postives = 296/366 (80.87%), Query Frame = 0
Query:   19 SEEELDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRA--NPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            S+EEL LA+ CDP+ CQLP+CRC+ T IPG L  RDTPQFV++TFDDAVNV+NIETYR  +Y+RRN N CP G TFYVNHEYT+YQ++NELYN GFEIALHS+SH T QT+W EA  EDM +EFGDQI QMA FANIP D+I G+R PFLQ++GNA+FQV+ + +L YDC+WPT++ ++PGLWPYTLDYAS QDC+IPPCP+A++PG WV+PM++WRDL   PC+M DSC   P  + E+ WFQFI RNFE HYFGNR+PFGF++HEWY+RA  NP V RALIRFLD+IN + DVFMVN+++V+DWVKNPVP+ EY Q+ C    PT C  A C P+ A+H E  YWM++C+ CP  YPW+GNPLG
Sbjct:   17 SQEELPLADTCDPEACQLPDCRCSGTSIPGGLQARDTPQFVLLTFDDAVNVVNIETYRNTIYNRRNRNNCPAGVTFYVNHEYTDYQLINELYNNGFEIALHSVSHMTNQTYWQEATYEDMTREFGDQIIQMAHFANIPSDSIKGVRIPFLQMTGNASFQVMADFNLEYDCTWPTVSHINPGLWPYTLDYASIQDCIIPPCPSASIPGPWVIPMITWRDLNDTPCSMVDSCLAVP--STEEEWFQFILRNFERHYFGNRAPFGFYIHEWYIRASVNPHVGRALIRFLDLINTLYDVFMVNSQEVIDWVKNPVPLEEYIQRPCKTYVPTFCPPATC-PVVAEHNENTYWMSICNVCPRVYPWLGNPLG 379          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|156968289|gb|ABU98616.1| (chitin binding PM protein [Helicoverpa armigera])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 231/360 (64.17%), Postives = 286/360 (79.44%), Query Frame = 0
Query:   23 LDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            L LAE CD + C LP+CRC+ST+IPG L PRD PQFV VTFDD V+V NI TYR++LY+R NSNGCP G TF+V+HEYTNY ++NELYNQGFEIALHSISHRTPQT+W EA  E +++E  DQ  QMA FANIP  AI G+R PFLQL+GNA+F+++ E  L YDC+WPTI   +PGLWPYTLDYASTQDC+IPPCP+A++PGVWV PMV+W DL G+PC+M D+CFF P   +E+ W++FI  NFE HY GNR+PFGF+VHE ++ ANPAV RAL+RF+D++NN+ D FMVN  +VVDWVKNP P+NEY  + C    P+TC    CGPL + H ++ Y+M VCS CP+NYPW+GNPLG
Sbjct:   30 LPLAEACDQEACSLPDCRCSSTNIPGGLNPRDVPQFVTVTFDDGVSVNNIITYRDILYNRLNSNGCPAGVTFFVSHEYTNYALINELYNQGFEIALHSISHRTPQTYWFEATKEVIKEEIADQKAQMAHFANIPPSAIKGVRMPFLQLAGNASFEIMAEYGLEYDCTWPTIAHTNPGLWPYTLDYASTQDCIIPPCPSASIPGVWVKPMVAWSDLNGVPCSMVDACFFIPDRENEEEWYKFILSNFERHYLGNRAPFGFYVHEAFLAANPAVNRALVRFMDLVNNLNDAFMVNAHEVVDWVKNPKPLNEYRSQGCRSFSPSTCNPNNCGPLFSTHNQLAYYMQVCSACPSNYPWVGNPLG 389          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|283826819|gb|ADB43611.1| (chitin deacetylase 5a [Helicoverpa armigera])

HSP 1 Score: 525.398 bits (1352), Expect = 0.000e+0
Identity = 230/360 (63.89%), Postives = 284/360 (78.89%), Query Frame = 0
Query:   23 LDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            L LAE CD + C LP+CRC+ST+IPG L PRD PQFV VTFDD VNV NI TYR +LY+R NSNGCP G TF+V+HEYTNY ++NELYNQGFEIALHSISHRTPQT+W EA  E +++E  DQ  QMA FANIP  AI G+R PFLQL+GNA+F+++ E  L YDC+WPTI   +PGLWPYTLDYASTQDC+IPPCP+A++PGVWV PMV+W DL G+PC+M D+CFF P   +E+ W++FI  NFE HY GNR+PFGF+VHE ++ ANPAV RAL+RF+D++NN+ D FMVN  +V+DWVKNP P+NEY  + C    P+ C    CGPL + H ++ Y+M VCS CP+NYPW+GNPLG
Sbjct:   30 LPLAEACDQEACSLPDCRCSSTNIPGGLNPRDVPQFVTVTFDDGVNVNNIITYRNILYNRLNSNGCPAGVTFFVSHEYTNYALINELYNQGFEIALHSISHRTPQTYWFEATKEVIKEEIADQKAQMAHFANIPPSAIKGVRMPFLQLAGNASFEIMSEYGLEYDCTWPTIAPTNPGLWPYTLDYASTQDCIIPPCPSASIPGVWVKPMVAWSDLNGVPCSMVDACFFIPDRENEEEWYKFILSNFERHYLGNRAPFGFYVHEAFLAANPAVNRALVRFMDLVNNLNDAFMVNAHEVIDWVKNPKPLNEYRSQGCRSFTPSICNPNNCGPLFSTHNQLAYYMQVCSACPSNYPWVGNPLG 389          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|171740881|gb|ACB54935.1| (chitin deacetylase, partial [Helicoverpa armigera])

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 236/360 (65.56%), Postives = 285/360 (79.17%), Query Frame = 0
Query:   23 LDLAEPCDPQTCQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            L LAE CD + C+LP+CRC+ST+IPG L PRDTPQFV VTFDD VNVINI TYREVL  R+NSNGCP G TFYV+HEYTNY+IVNELYN G+EIALHSISH+ PQ WW  A  +++++E  DQ  QMA FANIP ++I G+R PFLQL+GN +FQV+ +  L YDCSWPT T  DPGLWPYTLDYAS QDC+IPPCPTA++P  WV+PMVSW+DL   PCAMADSCF+TP M DE+AWFQFI  NFE HY GNR+PFGF+VHEWY+ ANPAV+ A IRFL++IN++PDVFMVN+ +V+DWVKNPVP+ EY  K C       C  ++CG + ++H +M YW+  C+ CP  YPW GNPLG
Sbjct:   30 LPLAEECDEELCKLPDCRCSSTEIPGGLLPRDTPQFVTVTFDDGVNVININTYREVLDGRQNSNGCPAGATFYVSHEYTNYRIVNELYNNGYEIALHSISHKIPQDWWATATYDELKEEIADQRTQMAHFANIPFESIKGVRLPFLQLAGNTSFQVMADHDLLYDCSWPTNTFTDPGLWPYTLDYASEQDCMIPPCPTASIPKPWVLPMVSWKDLNDFPCAMADSCFYTPDMEDEEAWFQFIVSNFERHYLGNRAPFGFYVHEWYLSANPAVKSAFIRFLNLINSLPDVFMVNSSEVIDWVKNPVPLTEYRAKPCRTWSSAACPVSLCGNVPSEHNQMTYWLEACNVCPRVYPWTGNPLG 389          
BLAST of HiSeq13276 vs. genbank:protein
Match: gi|187884602|gb|ACD37362.1| (chitin deacetylase 1 [Mamestra configurata])

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 232/368 (63.04%), Postives = 286/368 (77.72%), Query Frame = 0
Query:   16 AQNSEEELDLAEPCDPQT-CQLPECRCASTDIPGNLAPRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEYTNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMAQFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGLWPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFFTPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIRFLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVCGPLTADHTEMQYWMAVCSQCPTNYPWIGNPLG 382
            +   E  L  AE C P+T C+LP CRC+ST+IPG L P+DTPQFV VTFDD +NV NI TYR  LY+RRNSNGCP G TFYV+HEYTNY IVNELYNQGFEIALHSISH+TPQT+W EA  +DM++EFGDQ  Q+A FANIP ++I G+R PFLQ++GNA+F+++KE  L YDC+WPT +  +PGLWPYTLDYASTQDC++PPCPTA+ PG WV P+V+W DLQG+ C+  D+CFF P   DEDAW++FI  NFE HY GNR+PFGFFVHE ++ A PAV  A +RFLD+INN+PD FMVN+ +V+DWVKNPVP+++Y  + C    P  C    CGPL + H  M YWM +C+ CP  YPW+GNPLG
Sbjct:   22 SSKEEAGLKEAEECTPETVCELPNCRCSSTNIPGGLQPKDTPQFVTVTFDDGINVNNILTYRNTLYNRRNSNGCPAGATFYVSHEYTNYVIVNELYNQGFEIALHSISHQTPQTYWFEATKDDMKREFGDQKIQIAHFANIPYESIKGLRIPFLQMTGNASFEIMKEYGLEYDCTWPTTSHTNPGLWPYTLDYASTQDCIVPPCPTASFPGTWVKPLVTWSDLQGVACSFVDACFFIPDRADEDAWYKFILTNFERHYLGNRAPFGFFVHEAFLSAFPAVRGAFVRFLDLINNLPDTFMVNSHEVIDWVKNPVPIDKYKAQGCRRFNPRACVARSCGPLNSGHNGMDYWMQICNVCPRVYPWLGNPLG 389          
The following BLAST results are available for this feature:
BLAST of HiSeq13276 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909558149|ref|XP_013134076.1|0.000e+066.40PREDICTED: uncharacterized protein LOC106099929 [P... [more]
gi|910330731|ref|XP_013168673.1|0.000e+065.34PREDICTED: uncharacterized protein LOC106118554 [P... [more]
gi|943966544|ref|XP_014365314.1|0.000e+064.55PREDICTED: uncharacterized protein LOC106716323 [P... [more]
gi|512894542|ref|XP_004923455.1|0.000e+064.27PREDICTED: uncharacterized protein LOC101735686 [B... [more]
gi|913312134|ref|XP_013186778.1|0.000e+063.80PREDICTED: uncharacterized protein LOC106132023 [A... [more]
gi|913311973|ref|XP_013186691.1|0.000e+065.30PREDICTED: uncharacterized protein LOC106131956 [A... [more]
gi|156968289|gb|ABU98616.1|0.000e+064.17chitin binding PM protein [Helicoverpa armigera][more]
gi|283826819|gb|ADB43611.1|0.000e+063.89chitin deacetylase 5a [Helicoverpa armigera][more]
gi|171740881|gb|ACB54935.1|0.000e+065.56chitin deacetylase, partial [Helicoverpa armigera][more]
gi|187884602|gb|ACD37362.1|0.000e+063.04chitin deacetylase 1 [Mamestra configurata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
molecular_function GO:0016798 hydrolase activity, acting on glycosyl bonds
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002509Polysaccharide deacetylasePFAMPF01522Polysacc_deac_1coord: 54..186
e-value: 2.1E-6
score: 27.2
IPR002509Polysaccharide deacetylaseGENE3D3.20.20.370coord: 54..329
e-value: 3.8E-17
score: 61.9
NoneNo IPR availablePANTHERPTHR11177CHITINASEcoord: 26..382
NoneNo IPR availablePANTHERPTHR11177:SF104CHITIN DEACETYLASE-LIKE 4coord: 26..382
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 12..16
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..16
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 17..382
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..11
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.883
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..16
score: 0.578
IPR011330Glycoside hydrolase/deacetylase, beta/alpha-barrelSUPERFAMILY88713Glycoside hydrolase/deacetylasecoord: 14..329

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13276HiSeq13276Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13276_p ID=HiSeq13276_p|Name=HiSeq13276|organism=Ostrinia scapulalis|type=polypeptide|length=383bp
KMRWSWILLLAAVALAQNSEEELDLAEPCDPQTCQLPECRCASTDIPGNL
APRDTPQFVMVTFDDAVNVINIETYREVLYDRRNSNGCPVGTTFYVNHEY
TNYQIVNELYNQGFEIALHSISHRTPQTWWHEAGLEDMRQEFGDQIEQMA
QFANIPQDAIHGIRSPFLQLSGNATFQVIKETSLTYDCSWPTITSLDPGL
WPYTLDYASTQDCVIPPCPTAALPGVWVVPMVSWRDLQGIPCAMADSCFF
TPPMNDEDAWFQFITRNFESHYFGNRSPFGFFVHEWYVRANPAVERALIR
FLDVINNIPDVFMVNTKDVVDWVKNPVPVNEYSQKACNLNQPTTCRQAVC
GPLTADHTEMQYWMAVCSQCPTNYPWIGNPLGN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0003824catalytic activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR011330Glyco_hydro/deAcase_b/a-brl
IPR002509Polysac_deacetylase