HiSeq13298_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13298
Unique NameHiSeq13298_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length99
Homology
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|913319306|ref|XP_013190720.1| (PREDICTED: rab11 family-interacting protein 4 isoform X3 [Amyelois transitella])

HSP 1 Score: 172.17 bits (435), Expect = 2.013e-50
Identity = 84/100 (84.00%), Postives = 88/100 (88.00%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ 99
            MGE I+VEDSLELEYDMWDGQFDFVGPQ PP E R RITSDTS+TEDLFTGGPLTPHLTNG+NGGKKTAAHQWCDNLSDQV      +LQQQ TSLADTQ
Sbjct:   14 MGEPIDVEDSLELEYDMWDGQFDFVGPQGPPPEVRGRITSDTSITEDLFTGGPLTPHLTNGVNGGKKTAAHQWCDNLSDQVL-----MLQQQVTSLADTQ 108          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|357612570|gb|EHJ68065.1| (hypothetical protein KGM_01227 [Danaus plexippus])

HSP 1 Score: 162.54 bits (410), Expect = 9.922e-47
Identity = 80/99 (80.81%), Postives = 85/99 (85.86%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPPEPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ 99
            MGE I+VEDSLELEYDMWDGQFDFVGPQ+ P  R RITSDTS+ EDLFTGGPLTPHLTNG+NGGKKT AHQWCDNLSD     Q+Q LQQQ TSLADTQ
Sbjct:    1 MGESIDVEDSLELEYDMWDGQFDFVGPQETP-IRDRITSDTSVPEDLFTGGPLTPHLTNGVNGGKKTPAHQWCDNLSD-----QLQRLQQQVTSLADTQ 93          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|914566800|gb|KOB71292.1| (Rab11 family-interacting protein 4 [Operophtera brumata])

HSP 1 Score: 147.132 bits (370), Expect = 3.974e-44
Identity = 71/81 (87.65%), Postives = 74/81 (91.36%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQV 80
            M +QIEVEDSLELEYDMWDGQFDFVGPQDPP + R RITSD SLTEDLFTGGPLTPHL NG+NGGKKTAAH WCDNLSDQV
Sbjct:    1 MSDQIEVEDSLELEYDMWDGQFDFVGPQDPPPDARARITSDASLTEDLFTGGPLTPHLPNGVNGGKKTAAHLWCDNLSDQV 81          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|827558791|ref|XP_012550490.1| (PREDICTED: rab11 family-interacting protein 4 isoform X3 [Bombyx mori])

HSP 1 Score: 155.992 bits (393), Expect = 4.244e-44
Identity = 83/100 (83.00%), Postives = 85/100 (85.00%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ 99
            MG+ IEVEDSLELEYDMWDGQFDFVGPQ PP E R RITSD SLTEDLFTGGPLTPHL+NGLNGGKKTAAHQWCDNLSDQV        QQQ TSLADTQ
Sbjct:   14 MGDPIEVEDSLELEYDMWDGQFDFVGPQGPPPEVRNRITSDASLTEDLFTGGPLTPHLSNGLNGGKKTAAHQWCDNLSDQVQLL-----QQQVTSLADTQ 108          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|930666163|gb|KPJ07286.1| (hypothetical protein RR48_07702 [Papilio machaon])

HSP 1 Score: 143.665 bits (361), Expect = 6.385e-43
Identity = 70/81 (86.42%), Postives = 73/81 (90.12%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQV 80
            MGE IEVEDSL+LEYDMWDGQFDFVGPQ PP   R RITSD S+TEDLFTG PLTPHLTNG+NGGKKTAAHQWCDNLSDQV
Sbjct:    1 MGESIEVEDSLDLEYDMWDGQFDFVGPQGPPPVTRGRITSDISITEDLFTGTPLTPHLTNGVNGGKKTAAHQWCDNLSDQV 81          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|930654925|gb|KPI97257.1| (Rab11 family-interacting protein 3 [Papilio xuthus])

HSP 1 Score: 150.599 bits (379), Expect = 3.847e-42
Identity = 80/100 (80.00%), Postives = 83/100 (83.00%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ 99
            MGE IEVEDSL+LEYDMWDGQFDFVGPQ PP   R RITSD S+TEDLFTG PLTPHLTNG+NGGKKTAAHQWCDNLSDQV        QQQ TSLADTQ
Sbjct:    1 MGESIEVEDSLDLEYDMWDGQFDFVGPQGPPPVTRGRITSDISITEDLFTGTPLTPHLTNGVNGGKKTAAHQWCDNLSDQVQLL-----QQQVTSLADTQ 95          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|910337410|ref|XP_013172268.1| (PREDICTED: rab11 family-interacting protein 4A isoform X4 [Papilio xuthus])

HSP 1 Score: 150.214 bits (378), Expect = 5.947e-42
Identity = 80/100 (80.00%), Postives = 83/100 (83.00%), Query Frame = 0
Query:    1 MGEQIEVEDSLELEYDMWDGQFDFVGPQDPP-EPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ 99
            MGE IEVEDSL+LEYDMWDGQFDFVGPQ PP   R RITSD S+TEDLFTG PLTPHLTNG+NGGKKTAAHQWCDNLSDQV        QQQ TSLADTQ
Sbjct:   14 MGESIEVEDSLDLEYDMWDGQFDFVGPQGPPPVTRGRITSDISITEDLFTGTPLTPHLTNGVNGGKKTAAHQWCDNLSDQVQLL-----QQQVTSLADTQ 108          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|1069823725|ref|XP_018334601.1| (PREDICTED: rab11 family-interacting protein 4B-like isoform X2 [Agrilus planipennis])

HSP 1 Score: 64.6994 bits (156), Expect = 3.403e-10
Identity = 38/87 (43.68%), Postives = 47/87 (54.02%), Query Frame = 0
Query:   12 ELEYDMWDGQFDFVGPQDPPEPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADT 98
            E+EYDMW+GQF+FVGP +     P         + L    P  P  T   NG KKTAAH WC+ ++D     Q QLLQQQ   L D+
Sbjct:   32 EMEYDMWEGQFEFVGPANDQTIEP---------QGLLKPPPFLPSHT---NGAKKTAAHVWCEGITD-----QFQLLQQQVGVLQDS 101          
BLAST of HiSeq13298 vs. genbank:protein
Match: gi|1069823722|ref|XP_018334599.1| (PREDICTED: rab11 family-interacting protein 4B-like isoform X1 [Agrilus planipennis])

HSP 1 Score: 64.6994 bits (156), Expect = 3.604e-10
Identity = 38/87 (43.68%), Postives = 47/87 (54.02%), Query Frame = 0
Query:   12 ELEYDMWDGQFDFVGPQDPPEPRPRITSDTSLTEDLFTGGPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADT 98
            E+EYDMW+GQF+FVGP +     P         + L    P  P  T   NG KKTAAH WC+ ++D     Q QLLQQQ   L D+
Sbjct:   32 EMEYDMWEGQFEFVGPANDQTIEP---------QGLLKPPPFLPSHT---NGAKKTAAHVWCEGITD-----QFQLLQQQVGVLQDS 101          
The following BLAST results are available for this feature:
BLAST of HiSeq13298 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 9
Match NameE-valueIdentityDescription
gi|913319306|ref|XP_013190720.1|2.013e-5084.00PREDICTED: rab11 family-interacting protein 4 isof... [more]
gi|357612570|gb|EHJ68065.1|9.922e-4780.81hypothetical protein KGM_01227 [Danaus plexippus][more]
gi|914566800|gb|KOB71292.1|3.974e-4487.65Rab11 family-interacting protein 4 [Operophtera br... [more]
gi|827558791|ref|XP_012550490.1|4.244e-4483.00PREDICTED: rab11 family-interacting protein 4 isof... [more]
gi|930666163|gb|KPJ07286.1|6.385e-4386.42hypothetical protein RR48_07702 [Papilio machaon][more]
gi|930654925|gb|KPI97257.1|3.847e-4280.00Rab11 family-interacting protein 3 [Papilio xuthus... [more]
gi|910337410|ref|XP_013172268.1|5.947e-4280.00PREDICTED: rab11 family-interacting protein 4A iso... [more]
gi|1069823725|ref|XP_018334601.1|3.403e-1043.68PREDICTED: rab11 family-interacting protein 4B-lik... [more]
gi|1069823722|ref|XP_018334599.1|3.604e-1043.68PREDICTED: rab11 family-interacting protein 4B-lik... [more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13298HiSeq13298Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13298_p ID=HiSeq13298_p|Name=HiSeq13298|organism=Ostrinia scapulalis|type=polypeptide|length=99bp
MGEQIEVEDSLELEYDMWDGQFDFVGPQDPPEPRPRITSDTSLTEDLFTG
GPLTPHLTNGLNGGKKTAAHQWCDNLSDQVFGPQVQLLQQQGTSLADTQ
back to top