HiSeq13302_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13302
Unique NameHiSeq13302_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length204
Homology
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|910331614|ref|XP_013169137.1| (PREDICTED: boophilin-G2-like [Papilio xuthus])

HSP 1 Score: 184.882 bits (468), Expect = 6.102e-56
Identity = 85/194 (43.81%), Postives = 129/194 (66.49%), Query Frame = 0
Query:    8 VLLFVVCVSVSGYEDVTLTTAVVKDETTPKPTLIHRRIQIDQNVEEISHSPLDLFRLRAQELRR-TRIDIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC 200
            ++L +V V      + TLT+  ++    PK T + +R    +N+E +         L A + R+ +  DIWNWDYWC+LQPK+GNCS  + R+YYD QIDQCV FTY+GC+ NKNNF +   CE+YC G  ++S+++ T+ ++C+LQ +AG+C+A+  ++YYD+N   C  F YGGCGGN+NRF++ + C+N C
Sbjct:    7 IILVLVYVMGKVVHNFTLTSPTIRQYVIPKTTKLLKR----RNMESVMFKSAPQIELPAIDRRKISPEDIWNWDYWCKLQPKLGNCSDFVTRYYYDTQIDQCVNFTYSGCDANKNNFESAEKCEQYCHGTTYLSLREETS-NYCALQQDAGICLALVRRYYYDINKDKCVIFHYGGCGGNRNRFNTKSDCLNDC 195          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|943971855|ref|XP_014367470.1| (PREDICTED: kunitz-type serine protease inhibitor Kunitz-1-like [Papilio machaon])

HSP 1 Score: 182.185 bits (461), Expect = 9.352e-55
Identity = 87/197 (44.16%), Postives = 130/197 (65.99%), Query Frame = 0
Query:    5 LDFVLLFVVCVSVSGYEDVTLTTAVVKDETTPKPTLIHRRIQIDQNVEEISHSPLDLFRLRAQELRR-TRIDIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC 200
            L  +L++V+   V  +   TLT+A ++  T PK T + +R    +N+E +         L   + R+ +  +IWNWDYWC+LQPK GNCS  +IR+YYD QIDQCV FTY+GC+GNKNNF +   CE+YC G  ++S+K+ T+ ++C+LQ +AG+C+A+   +YY++N   C  F YGGCGGN+NRF+    C++ C
Sbjct:   17 LVLILIYVIGKVVCNF---TLTSATIRQYTIPKTTKLMKR----RNMESVVFKAAPQIELPDIDRRKISPEEIWNWDYWCKLQPKTGNCSDFVIRYYYDIQIDQCVNFTYSGCDGNKNNFESAEKCEQYCHGTTYLSLKEETS-NYCALQQDAGICLAVVQMYYYEINKENCMVFHYGGCGGNRNRFNKKGDCLSDC 205          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|909574545|ref|XP_013142977.1| (PREDICTED: kunitz-type serine protease inhibitor A-like [Papilio polytes])

HSP 1 Score: 176.407 bits (446), Expect = 8.759e-53
Identity = 84/182 (46.15%), Postives = 119/182 (65.38%), Query Frame = 0
Query:   22 DVTLTTAVVKDETTPKPTLIHRRIQIDQNVEEISHSPLDLFRLRAQELRRTRID-IWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRCHQ 202
            + TLT+A+ +  T PK T   +R    +N++ I         L A + R+   D IWNWDYWC+LQ K G C     R+YYD QIDQCV FTY+GC+GNKNNF +   CE++C G  ++SIK+ T P++C+LQ +AG+C+A+   +YYD+N   C+ F YGGCGGN+NRF++   C+N C +
Sbjct:    4 NFTLTSAITRPHTIPKTTKFMKR----RNMDSILFKAAPQIELPAIDRRKISPDEIWNWDYWCKLQFKTGKCFNFTTRYYYDIQIDQCVNFTYSGCDGNKNNFNSAEICEQHCHGTTYLSIKEET-PNYCALQQDAGICLALVRMYYYDINKDDCRIFHYGGCGGNRNRFNTKLNCLNDCKE 180          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|827549949|ref|XP_012547025.1| (PREDICTED: BPTI/Kunitz domain-containing protein-like [Bombyx mori])

HSP 1 Score: 167.933 bits (424), Expect = 6.721e-50
Identity = 70/128 (54.69%), Postives = 95/128 (74.22%), Query Frame = 0
Query:   76 IWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRCHQD 203
            +W+WD WCQLQPK GNCS++++++YY+A +DQC+TF YTGC GN N F T  DCE  CKGA+ M I+++   ++CSLQ NAG C+ +  ++YYDVN+ATCK F YGGCGGNQN F++   C   C  +
Sbjct:   15 LWDWDIWCQLQPKKGNCSENVLKYYYNADLDQCLTFEYTGCQGNLNKFHTQADCEGRCKGASLMMIRESAPITYCSLQVNAGYCLGLLRRYYYDVNEATCKEFTYGGCGGNQNNFETMRKCSRECQTN 142          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|913299969|ref|XP_013198315.1| (PREDICTED: boophilin-H2-like [Amyelois transitella])

HSP 1 Score: 157.532 bits (397), Expect = 1.575e-45
Identity = 64/126 (50.79%), Postives = 88/126 (69.84%), Query Frame = 0
Query:   75 DIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC 200
            ++W WD +C LQP  GNC   + RFYYDAQ+D+C  FT++GC GNKNNF +  +CER CKGA F+ + +   P+ C LQP++GLC+ +   +YYDV+D  CK F++GGCGGN NRF++   C   C
Sbjct:   35 EVWVWDLYCHLQPLKGNCKDKLKRFYYDAQLDKCANFTFSGCKGNKNNFESELECERRCKGANFLGVNEQQLPTVCFLQPDSGLCLVLLTHYYYDVDDRKCKPFMFGGCGGNLNRFETMAQCDEYC 160          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|913299972|ref|XP_013198325.1| (PREDICTED: protein AMBP-like [Amyelois transitella])

HSP 1 Score: 153.68 bits (387), Expect = 4.300e-43
Identity = 67/130 (51.54%), Postives = 87/130 (66.92%), Query Frame = 0
Query:   71 RTRIDIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC 200
            R   DIW WD +CQLQP  GNCS+++ R+YYDAQ+D C  F Y+GC GNKNNF +   CE+ CKGA+F+ +   + P  C LQ ++GLC+A   ++YYDVN   C  F YGGC GN NRFD+ + C   C
Sbjct:  103 RQSKDIWIWDLFCQLQPAKGNCSENLFRYYYDAQMDACAVFQYSGCGGNKNNFESHLLCEQRCKGASFLLVSVQSLPLVCYLQADSGLCLAFVTRYYYDVNKGECLPFTYGGCNGNLNRFDTKSDCDEHC 232          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|930667121|gb|KPJ08209.1| (Tissue factor pathway inhibitor [Papilio machaon])

HSP 1 Score: 145.206 bits (365), Expect = 1.340e-40
Identity = 70/159 (44.03%), Postives = 106/159 (66.67%), Query Frame = 0
Query:    5 LDFVLLFVVCVSVSGYEDVTLTTAVVKDETTPKPTLIHRRIQIDQNVEEISHSPLDLFRLRAQELRR-TRIDIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAM 162
            L  +L++V+   V  +   TLT+A ++  T PK T + +R    +N+E +         L   + R+ +  +IWNWDYWC+LQPK GNCS  +IR+YYD QIDQCV FTY+GC+GNKNNF +   CE+YC G  ++S+K+ T+ ++C+LQ +AG+C+A+
Sbjct:   27 LVLILIYVIGKVVCNF---TLTSATIRQYTIPKTTKLMKR----RNMESVVFKAAPQIELPDIDRRKISPEEIWNWDYWCKLQPKTGNCSDFVIRYYYDIQIDQCVNFTYSGCDGNKNNFESAEKCEQYCHGTTYLSLKEETS-NYCALQQDAGICLAV 177          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|357624825|gb|EHJ75455.1| (putative boophilin-like protein [Danaus plexippus])

HSP 1 Score: 135.961 bits (341), Expect = 2.929e-37
Identity = 57/124 (45.97%), Postives = 85/124 (68.55%), Query Frame = 0
Query:   78 NWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRCH 201
            +WD +CQLQP+ G+C   + RFYYD + ++C +F + GC+GN+NNF T+ +CER+CK + +++I  +   S C+LQP  G C+A+   +YYD+N+  CK F YGGCGGN N+F +   CM  C 
Sbjct:   26 SWDSFCQLQPRKGSCGNQLKRFYYDMESNECRSFYFGGCDGNQNNFNTLLECERFCKDSKYLNIDGSRRVSPCNLQPETGFCLALINMYYYDINEKKCKIFKYGGCGGNDNKFRTRALCMRACK 149          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|1041148103|ref|XP_017260744.1| (PREDICTED: kunitz-type protease inhibitor 2-like [Kryptolebias marmoratus])

HSP 1 Score: 117.857 bits (294), Expect = 1.770e-29
Identity = 51/121 (42.15%), Postives = 71/121 (58.68%), Query Frame = 0
Query:   83 CQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKD---TTNPSFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC 200
            C+ +P++G C  +M R+Y++ +   C TFTY GC GNKNN+    +C+  C G   +         +   C L P  G C A + KFYYD + A+C+ F+YGGCGGN N FDS   CM+RC
Sbjct:   15 CEAEPQVGPCRAAMKRWYFNKETGSCQTFTYGGCRGNKNNYENEDNCKTTCAGVKVLPSSKKAPAADQELCGLSPEPGRCRAAFPKFYYDPSSASCQSFLYGGCGGNANNFDSVEECMSRC 135          
BLAST of HiSeq13302 vs. genbank:protein
Match: gi|831510102|ref|XP_012713786.1| (PREDICTED: kunitz-type serine protease inhibitor 6-like [Fundulus heteroclitus])

HSP 1 Score: 117.472 bits (293), Expect = 2.061e-27
Identity = 56/151 (37.09%), Postives = 81/151 (53.64%), Query Frame = 0
Query:   58 PLDLFRLRAQELRRTRIDIWNWDYWCQLQPKMGNCSQSMIRFYYDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNP----SFCSLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRCHQDA 204
            P +     +  L++  I    +   C+ + + G C  +M R++Y+ +   C TF Y GC GNKNN+ +   C+  C G   +      NP    S CSL P +G+C A + KFYYD + A+C+ F+YGGCGGN N+FDS   CM  C  D 
Sbjct:  242 PAESGPAESALLQKADIQADEYAELCEAEYQTGPCRAAMKRWFYNKEKGSCQTFIYGGCKGNKNNYRSEESCKSTCTGVKVLP-SSKKNPEDDKSRCSLSPESGMCRAAFPKFYYDPSSASCQTFVYGGCGGNGNKFDSLEECMTACSGDG 391          
The following BLAST results are available for this feature:
BLAST of HiSeq13302 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910331614|ref|XP_013169137.1|6.102e-5643.81PREDICTED: boophilin-G2-like [Papilio xuthus][more]
gi|943971855|ref|XP_014367470.1|9.352e-5544.16PREDICTED: kunitz-type serine protease inhibitor K... [more]
gi|909574545|ref|XP_013142977.1|8.759e-5346.15PREDICTED: kunitz-type serine protease inhibitor A... [more]
gi|827549949|ref|XP_012547025.1|6.721e-5054.69PREDICTED: BPTI/Kunitz domain-containing protein-l... [more]
gi|913299969|ref|XP_013198315.1|1.575e-4550.79PREDICTED: boophilin-H2-like [Amyelois transitella... [more]
gi|913299972|ref|XP_013198325.1|4.300e-4351.54PREDICTED: protein AMBP-like [Amyelois transitella... [more]
gi|930667121|gb|KPJ08209.1|1.340e-4044.03Tissue factor pathway inhibitor [Papilio machaon][more]
gi|357624825|gb|EHJ75455.1|2.929e-3745.97putative boophilin-like protein [Danaus plexippus][more]
gi|1041148103|ref|XP_017260744.1|1.770e-2942.15PREDICTED: kunitz-type protease inhibitor 2-like [... [more]
gi|831510102|ref|XP_012713786.1|2.061e-2737.09PREDICTED: kunitz-type serine protease inhibitor 6... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0004867 serine-type endopeptidase inhibitor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Proteinase inhibitor I2, Kunitz metazoaPRINTSPR00759BASICPTASEcoord: 175..185
score: 65.38
coord: 185..200
score: 44.1
coord: 147..161
score: 34.09
IPR002223Proteinase inhibitor I2, Kunitz metazoaSMARTSM00131KUcoord: 148..201
e-value: 8.3E-18
score: 75.2
coord: 81..134
e-value: 8.0E-22
score: 88.5
IPR002223Proteinase inhibitor I2, Kunitz metazoaPFAMPF00014Kunitz_BPTIcoord: 149..200
e-value: 4.4E-15
score: 55.4
coord: 83..134
e-value: 5.3E-17
score: 61.6
IPR002223Proteinase inhibitor I2, Kunitz metazoaGENE3D4.10.410.10coord: 146..201
e-value: 1.5E-18
score: 66.1
IPR002223Proteinase inhibitor I2, Kunitz metazoaGENE3D4.10.410.10coord: 82..134
e-value: 7.6E-20
score: 70.3
IPR002223Proteinase inhibitor I2, Kunitz metazoaPROSITEPS50279BPTI_KUNITZ_2coord: 150..200
score: 14.192
IPR002223Proteinase inhibitor I2, Kunitz metazoaPROSITEPS50279BPTI_KUNITZ_2coord: 83..133
score: 15.069
IPR002223Proteinase inhibitor I2, Kunitz metazoaSUPERFAMILY57362BPTI-likecoord: 144..201
IPR002223Proteinase inhibitor I2, Kunitz metazoaSUPERFAMILY57362BPTI-likecoord: 77..135
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 83..200
coord: 12..23
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 7..15
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..6
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 20..204
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..19
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 16..19
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.758
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 111..129
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 178..196

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13302HiSeq13302Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13302_p ID=HiSeq13302_p|Name=HiSeq13302|organism=Ostrinia scapulalis|type=polypeptide|length=204bp
MKKGLDFVLLFVVCVSVSGYEDVTLTTAVVKDETTPKPTLIHRRIQIDQN
VEEISHSPLDLFRLRAQELRRTRIDIWNWDYWCQLQPKMGNCSQSMIRFY
YDAQIDQCVTFTYTGCNGNKNNFATVTDCERYCKGAAFMSIKDTTNPSFC
SLQPNAGLCMAMYFKFYYDVNDATCKRFIYGGCGGNQNRFDSATYCMNRC
HQDA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: INTERPRO
TermDefinition
IPR020901Prtase_inh_Kunz-CS
IPR002223Prot_inh_Kunz-m