HiSeq13304_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13304
Unique NameHiSeq13304_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length64
Homology
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|357601872|gb|EHJ63174.1| (Coiled-coil domain-containing protein 72 [Danaus plexippus])

HSP 1 Score: 90.5077 bits (223), Expect = 9.607e-23
Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKK ++ELDDDDLALKQKLKEQQKALQDAK+KA+QKGPLTQGGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKTSKELDDDDLALKQKLKEQQKALQDAKAKATQKGPLTQGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|943963344|ref|XP_014363988.1| (PREDICTED: translation machinery-associated protein 7 homolog [Papilio machaon] >gi|943963347|ref|XP_014363991.1| PREDICTED: translation machinery-associated protein 7 homolog [Papilio machaon] >gi|930670182|gb|KPJ11005.1| Coiled-coil domain-containing protein 72-like [Papilio machaon])

HSP 1 Score: 89.3521 bits (220), Expect = 2.976e-22
Identity = 59/64 (92.19%), Postives = 62/64 (96.88%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKKE RELDDDDLA KQKLKEQQKALQ+AK+KA+QKGPLTQGGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKEQRELDDDDLAHKQKLKEQQKALQEAKAKATQKGPLTQGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|389610135|dbj|BAM18679.1| (coiled-coil domain-containing protein 72 homolog [Papilio xuthus] >gi|930654248|gb|KPI96583.1| Coiled-coil domain-containing protein 72-like [Papilio xuthus])

HSP 1 Score: 87.8113 bits (216), Expect = 1.325e-21
Identity = 58/64 (90.62%), Postives = 62/64 (96.88%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGR+GGKKKPLKAPKKE RELDDDDLA KQKLKEQQKALQ+AK+KA+QKGPLTQGGIKKSGKK
Sbjct:    1 MSGRDGGKKKPLKAPKKEQRELDDDDLAHKQKLKEQQKALQEAKAKATQKGPLTQGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|512935530|ref|XP_004933296.1| (PREDICTED: translation machinery-associated protein 7 homolog [Bombyx mori])

HSP 1 Score: 86.2705 bits (212), Expect = 4.059e-21
Identity = 56/64 (87.50%), Postives = 63/64 (98.44%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKKE++E+D+DDLA KQKLKEQQKALQ+AK+KA+QKGPLTQGGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKESKEMDEDDLAHKQKLKEQQKALQEAKAKATQKGPLTQGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|913306183|ref|XP_013183511.1| (PREDICTED: translation machinery-associated protein 7 homolog [Amyelois transitella])

HSP 1 Score: 85.8853 bits (211), Expect = 6.799e-21
Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKK+ +ELD+DDLA KQKLKEQQKALQ+AK+KASQKGPLTQGGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKDTKELDEDDLAHKQKLKEQQKALQEAKAKASQKGPLTQGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|1133414269|ref|XP_019877609.1| (PREDICTED: translation machinery-associated protein 7 homolog [Aethina tumida])

HSP 1 Score: 79.337 bits (194), Expect = 3.072e-18
Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKK+ RE+D+DDLA KQKLKEQQKAL +AK+KASQKGP+  GGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKDQREMDEDDLAHKQKLKEQQKALNEAKAKASQKGPMGSGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|985403814|ref|XP_015369613.1| (PREDICTED: translation machinery-associated protein 7 homolog [Diuraphis noxia] >gi|985403820|ref|XP_015369614.1| PREDICTED: translation machinery-associated protein 7 homolog [Diuraphis noxia])

HSP 1 Score: 78.9518 bits (193), Expect = 3.662e-18
Identity = 51/64 (79.69%), Postives = 58/64 (90.62%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLK PKKE+++LD+DDL +KQKLKEQQKAL D KSKA+QKGP+  GGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKNPKKESKDLDEDDLKMKQKLKEQQKALNDLKSKAAQKGPMVSGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|974104055|ref|XP_015250911.1| (PREDICTED: translation machinery-associated protein 7 [Cyprinodon variegatus])

HSP 1 Score: 71.2478 bits (173), Expect = 4.682e-15
Identity = 48/64 (75.00%), Postives = 57/64 (89.06%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKK+ +E+DD+D+A KQK KE+QKA++  K+KAS KGPLT GGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKQNKEMDDEDVAFKQKQKEEQKAMEALKAKASGKGPLTSGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|317418604|emb|CBN80642.1| (Coiled-coil domain-containing protein 72 [Dicentrarchus labrax])

HSP 1 Score: 70.8626 bits (172), Expect = 6.159e-15
Identity = 48/64 (75.00%), Postives = 57/64 (89.06%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLTQGGIKKSGKK 64
            MSGREGGKKKPLKAPKK+++E+DDD++A KQK KE QKA++  K+KAS KGPLT GGIKKSGKK
Sbjct:    1 MSGREGGKKKPLKAPKKQSKEMDDDEVAFKQKQKEDQKAMEALKAKASGKGPLTSGGIKKSGKK 64          
BLAST of HiSeq13304 vs. genbank:protein
Match: gi|768445976|ref|XP_011564911.1| (PREDICTED: translation machinery-associated protein 7 homolog [Plutella xylostella])

HSP 1 Score: 70.4774 bits (171), Expect = 9.657e-15
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 0
Query:    1 MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQKGPLT 54
            MSGREGGKKKPLKAPKK+  ELDDDDLALKQK+KEQQKALQ+AK+KASQKGPLT
Sbjct:    1 MSGREGGKKKPLKAPKKDKAELDDDDLALKQKMKEQQKALQEAKAKASQKGPLT 54          
The following BLAST results are available for this feature:
BLAST of HiSeq13304 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357601872|gb|EHJ63174.1|9.607e-2392.19Coiled-coil domain-containing protein 72 [Danaus p... [more]
gi|943963344|ref|XP_014363988.1|2.976e-2292.19PREDICTED: translation machinery-associated protei... [more]
gi|389610135|dbj|BAM18679.1|1.325e-2190.63coiled-coil domain-containing protein 72 homolog [... [more]
gi|512935530|ref|XP_004933296.1|4.059e-2187.50PREDICTED: translation machinery-associated protei... [more]
gi|913306183|ref|XP_013183511.1|6.799e-2189.06PREDICTED: translation machinery-associated protei... [more]
gi|1133414269|ref|XP_019877609.1|3.072e-1882.81PREDICTED: translation machinery-associated protei... [more]
gi|985403814|ref|XP_015369613.1|3.662e-1879.69PREDICTED: translation machinery-associated protei... [more]
gi|974104055|ref|XP_015250911.1|4.682e-1575.00PREDICTED: translation machinery-associated protei... [more]
gi|317418604|emb|CBN80642.1|6.159e-1575.00Coiled-coil domain-containing protein 72 [Dicentra... [more]
gi|768445976|ref|XP_011564911.1|9.657e-1588.89PREDICTED: translation machinery-associated protei... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 26..51
IPR015157Translation machinery associated TMA7PFAMPF09072TMA7coord: 2..64
e-value: 7.3E-26
score: 90.3

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13304HiSeq13304Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13304_p ID=HiSeq13304_p|Name=HiSeq13304|organism=Ostrinia scapulalis|type=polypeptide|length=64bp
MSGREGGKKKPLKAPKKEARELDDDDLALKQKLKEQQKALQDAKSKASQK
GPLTQGGIKKSGKK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR015157TMA7