HiSeq13305_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13305
Unique NameHiSeq13305_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length364
Homology
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|909578202|ref|XP_013144952.1| (PREDICTED: carbonic anhydrase 3-like [Papilio polytes])

HSP 1 Score: 393.66 bits (1010), Expect = 6.274e-133
Identity = 178/335 (53.13%), Postives = 235/335 (70.15%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRP---PRKVKFLRRGKKGQKKAETLKEWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E T+DQT++RAN L DDADD+Q+QLDNEARD++K G+PKTIWVFH PT FPDI  +  + RP     + K L +     +  E   EW YK+Q  W K+FPDCGGRSQSPVD+P  G V A+ GR+L+F NYD+ P+ +   NDG RV L  +W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL +++      +T +      PLS+F P FK+YA YQGS+TAPPCTE+VLW++R ++LPV RE + +A+ L    G+      R TQPLNDRK + F
Sbjct:   39 EETKDQTTSRANNLYDDADDLQKQLDNEARDKLKVGKPKTIWVFHLPTPFPDITYLVTSRRPRSADHQDKTLIKNNTKTEPVEAAAEWDYKNQNDWGKMFPDCGGRSQSPVDLPLQGFVKAKGGRRLLFTNYDLYPEKITVQNDGKRVVLFGQWDRNRMPLVYGGAAHSRRYIFHSLSFVWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFEDHTQKGLREVLSVLRKQSTFNNSAALHPLSYFVPRFKDYASYQGSLTAPPCTESVLWLVRARSLPVQREAIAAAQKLRSPYGDTQSFAVRFTQPLNDRKIFLF 373          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|910312682|ref|XP_013170990.1| (PREDICTED: carbonic anhydrase 1-like isoform X1 [Papilio xuthus])

HSP 1 Score: 389.037 bits (998), Expect = 3.152e-131
Identity = 177/335 (52.84%), Postives = 235/335 (70.15%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLK---EWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E ++DQT++R NTL DDADD+Q+QLDNEARD++K G+PKTIWVFH PT FPDI  +  + RP       +   K   K E +    +W YK+Q  W K FPDCGGRSQSPVD+P  G V A+ GR+L+F NYD+ P+ +   NDG RV L  +W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL ++++     +T +   T  PLS+F P FK+YA YQGS+TAPPCTE+VLW++R ++LPV RE + +A+ L    G+      R TQPLNDRK + F
Sbjct:   39 EDSKDQTTSRPNTLYDDADDLQKQLDNEARDKLKVGKPKTIWVFHLPTPFPDITYLVTSRRPRSASHQDKATSKNNTKTEPVDVTADWDYKNQNDWGKTFPDCGGRSQSPVDLPLQGFVKAKGGRRLLFTNYDLYPEKITVQNDGKRVVLFGEWDRNRMPLVYGGAAHSRRYIFHSLSFVWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFEDHTQKGLREVLRVLRRQSTFNVSATVHPLSYFVPRFKDYASYQGSLTAPPCTESVLWLVRARSLPVQREAITAAQKLRSPYGDTQSFAVRITQPLNDRKIFLF 373          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|943978382|ref|XP_014370163.1| (PREDICTED: carbonic anhydrase 1-like [Papilio machaon])

HSP 1 Score: 381.719 bits (979), Expect = 3.869e-128
Identity = 178/348 (51.15%), Postives = 235/348 (67.53%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLK---EWSYK-------------DQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E  +DQT++R NTL DDADD+Q+QLDNEARD++K G+PKTIWVFH PT FPDI  +    RP   +   +   K + KAE +    EW YK             DQ  W K FP+CGGRSQSPVD+P  G V A+ GR+L+F NY++ P  +   NDG RV L   W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL ++++     +T +   T  PLS+F P FK+YA YQGS+T+PPCTE+VLW++R ++LPV RET+ +A+ L    G+      R TQPLNDRK + F
Sbjct:   39 EDAKDQTTSRPNTLYDDADDLQKQLDNEARDKLKVGKPKTIWVFHLPTPFPDITYLVTTRRPRSAIHHNKSTCKNKTKAEPVDVSVEWDYKNPYRKFSFMHVSTDQNDWGKTFPECGGRSQSPVDLPLQGFVKAKGGRRLLFTNYNLYPKKITVKNDGKRVVLFGHWDRNRMPLVYGGAAHSRRYIFHSLSFMWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFGDHTQKGLREVLRVLRRQSTFNVSATVHPLSYFVPRFKDYASYQGSLTSPPCTESVLWLVRARSLPVQRETITAAQKLRSPYGDTQSFAVRLTQPLNDRKIFLF 386          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|512892234|ref|XP_004922881.1| (PREDICTED: carbonic anhydrase 1-like [Bombyx mori])

HSP 1 Score: 380.563 bits (976), Expect = 3.947e-128
Identity = 182/332 (54.82%), Postives = 229/332 (68.98%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLKEWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E T DQT++RANTL DDADDIQ+QL+ EA++R  YG PK IWVFH P +FP+ + V R        K     ++    A+   +W Y +Q  W K +P CGGRSQSPVD+P  GL+ AR GR L+F NYDV P+ M  I D  RVTL   W    RP ++GGAAHS RYVF+SL+LHWPSEHT+G LQYP+ESQ +H+SAEYN+++EA+  S  DPLA L ++ LY+++N TQ+GL  LI+ A   T     L  KPLS+F+PPFKEY+CY GS+TAPPCTEAVLW +R K LPV RE VES R +L +  E  K + R  QPLNDRK Y+F
Sbjct:   24 EFTHDQTTSRANTLFDDADDIQKQLEIEAKNRFVYGSPKAIWVFHLPPKFPEGHAVTRQLSSNYLSKPDAITQRAMFNADATYDWEYAEQNNWWKKYPQCGGRSQSPVDIPVKGLIKARRGRPLLFCNYDVPPENMTLIKDERRVTLTGFWDPKHRPLLHGGAAHSHRYVFYSLSLHWPSEHTIGNLQYPLESQALHISAEYNTLDEAVAASRRDPLAVLGIANLYKFANKTQKGLKMLIEAASRVTLKRKGLPTKPLSYFNPPFKEYSCYHGSLTAPPCTEAVLWFVRAKALPVQREAVESIRQIL-ISDEMRKSYSRQPQPLNDRKVYFF 354          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|910312684|ref|XP_013170998.1| (PREDICTED: carbonic anhydrase 1-like isoform X2 [Papilio xuthus])

HSP 1 Score: 380.948 bits (977), Expect = 4.249e-128
Identity = 176/335 (52.54%), Postives = 233/335 (69.55%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLK---EWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E ++DQT++R NTL DDADD+Q+QLDNEARD++K   PKTIWVFH PT FPDI  +  + RP       +   K   K E +    +W YK+Q  W K FPDCGGRSQSPVD+P  G V A+ GR+L+F NYD+ P+ +   NDG RV L  +W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL ++++     +T +   T  PLS+F P FK+YA YQGS+TAPPCTE+VLW++R ++LPV RE + +A+ L    G+      R TQPLNDRK + F
Sbjct:   39 EDSKDQTTSRPNTLYDDADDLQKQLDNEARDKLK---PKTIWVFHLPTPFPDITYLVTSRRPRSASHQDKATSKNNTKTEPVDVTADWDYKNQNDWGKTFPDCGGRSQSPVDLPLQGFVKAKGGRRLLFTNYDLYPEKITVQNDGKRVVLFGEWDRNRMPLVYGGAAHSRRYIFHSLSFVWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFEDHTQKGLREVLRVLRRQSTFNVSATVHPLSYFVPRFKDYASYQGSLTAPPCTESVLWLVRARSLPVQREAITAAQKLRSPYGDTQSFAVRITQPLNDRKIFLF 370          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|930664874|gb|KPJ06005.1| (Carbonic anhydrase 6 [Papilio machaon])

HSP 1 Score: 378.252 bits (970), Expect = 3.901e-127
Identity = 174/332 (52.41%), Postives = 230/332 (69.28%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLKEWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E  +DQT++R NTL DDADD+Q+QLDNEARD++K G+PKTIWVFH PT FPDI  +    RP   +   +   K + KAE        DQ  W K FP+CGGRSQSPVD+P  G V A+ GR+L+F NY++ P  +   NDG RV L   W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL ++++     +T +   T  PLS+F P FK+YA YQGS+T+PPCTE+VLW++R ++LPV RET+ +A+ L    G+      R TQPLNDRK + F
Sbjct:   39 EDAKDQTTSRPNTLYDDADDLQKQLDNEARDKLKVGKPKTIWVFHLPTPFPDITYLVTTRRPRSAIHHNKSTCKNKTKAEP-------DQNDWGKTFPECGGRSQSPVDLPLQGFVKAKGGRRLLFTNYNLYPKKITVKNDGKRVVLFGHWDRNRMPLVYGGAAHSRRYIFHSLSFMWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFGDHTQKGLREVLRVLRRQSTFNVSATVHPLSYFVPRFKDYASYQGSLTSPPCTESVLWLVRARSLPVQRETITAAQKLRSPYGDTQSFAVRLTQPLNDRKIFLF 363          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|930661472|gb|KPJ03400.1| (Carbonic anhydrase 6 [Papilio xuthus])

HSP 1 Score: 376.326 bits (965), Expect = 3.385e-126
Identity = 178/348 (51.15%), Postives = 239/348 (68.68%), Query Frame = 0
Query:   31 EATQDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFL----RRGKKGQKKAETLKE---WSYK---------DQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            E ++DQT++R NTL DDADD+Q+QLDNEARD++K G+PKTIWVFH PT FPDI  +  + RP   V+      R  ++G    E +K+   +S+          DQ  W K FPDCGGRSQSPVD+P  G V A+ GR+L+F NYD+ P+ +   NDG RV L  +W  N  P +YGGAAHSRRY+FHSL+  WPSEHT+GGLQ+P+ESQ +H+SAEY SM+EAL  + SDP AFL +  +Y++ +HTQ+GL ++++     +T +   T  PLS+F P FK+YA YQGS+TAPPCTE+VLW++R ++LPV RE + +A+ L    G+      R TQPLNDRK + F
Sbjct:   28 EDSKDQTTSRPNTLYDDADDLQKQLDNEARDKLKVGKPKTIWVFHLPTPFPDITYLVTSRRPRSAVEIKESMHRWCERGYVYIEIVKKMLMFSFTPCQPYLVSTDQNDWGKTFPDCGGRSQSPVDLPLQGFVKAKGGRRLLFTNYDLYPEKITVQNDGKRVVLFGEWDRNRMPLVYGGAAHSRRYIFHSLSFVWPSEHTIGGLQFPMESQALHISAEYGSMKEALDAAPSDPQAFLGIVNIYKFEDHTQKGLREVLRVLRRQSTFNVSATVHPLSYFVPRFKDYASYQGSLTAPPCTESVLWLVRARSLPVQREAITAAQKLRSPYGDTQSFAVRITQPLNDRKIFLF 375          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|357628201|gb|EHJ77599.1| (putative carbonic anhydrase [Danaus plexippus])

HSP 1 Score: 307.76 bits (787), Expect = 1.961e-100
Identity = 152/330 (46.06%), Postives = 205/330 (62.12%), Query Frame = 0
Query:   34 QDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQKKAETLKEWSY-KDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            Q++T+ R NTL DDADDIQ QLDNEARD+  +                               KF               EW+   DQ  WP+ +PDCGGRSQSPV++PY  LV A+  R+L+F NYDV P  +   NDG R+ L  +WK   +P IYGGAAHSRRY+FHSLTLH PSEH +GGLQ+P+E+QV+ +SAEY S  EA++ S+ D  AFL +  +Y+Y NHTQ+GL +L+K    +   +  ++  PL  F+PP ++YACYQGS+T PPCTE+VLW+IR K LP+TR+ +++A ++     ++     R  QPLNDR+ YYF
Sbjct:   11 QEKTTKRLNTLFDDADDIQPQLDNEARDKYMFA------------------------------KF---------------EWNMITDQHDWPRRYPDCGGRSQSPVNLPYTPLVKAKESRQLMFLNYDVLPKKLMLCNDGKRIALYGEWKPINQPLIYGGAAHSRRYLFHSLTLHRPSEHRIGGLQFPMETQVLFISAEYKSFAEAIKASLKDAQAFLGIVNIYKYDNHTQQGLEELLK--AGTKRFNTSMSLLPLGFFTPPLQQYACYQGSLTFPPCTESVLWLIRAKALPITRKAMDAASSI--FEEDHVGSCLREPQPLNDRRVYYF 291          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|913330948|ref|XP_013197022.1| (PREDICTED: alpha carbonic anhydrase 8-like, partial [Amyelois transitella])

HSP 1 Score: 250.366 bits (638), Expect = 5.438e-79
Identity = 123/233 (52.79%), Postives = 153/233 (65.67%), Query Frame = 0
Query:  130 CGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFLAVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRSTQPLNDRKAYYF 362
            CGGRSQSPV++P  GLV ++A +KL+F NYD +P +M   NDG RV L+ +WK   RP +YGGAA SRRYVFHSL LHWPSEHT+ GLQYPIESQV+H+SAEY   ++A+  S SDPLAFL +  +Y            +IK           L+PKPLS FSPPF++Y  Y GS+T PPCTE+VLW++RGK+LPV R+       L    G+     FR   PLNDR  Y F
Sbjct:    2 CGGRSQSPVNLPARGLVNSKA-KKLLFINYDTRPTSMSLQNDGKRVILLGEWKKQNRPLVYGGAAFSRRYVFHSLVLHWPSEHTISGLQYPIESQVLHISAEYRDFKDAVNRSSSDPLAFLGIVNIY------------MIK-----------LSPKPLSFFSPPFQKYVVYHGSLTTPPCTESVLWIVRGKSLPVNRDEFNVPYGLCNAWGQLDVKPFRLVNPLNDRGVYLF 210          
BLAST of HiSeq13305 vs. genbank:protein
Match: gi|768415969|ref|XP_011548555.1| (PREDICTED: carbonic anhydrase 15-like [Plutella xylostella])

HSP 1 Score: 203.756 bits (517), Expect = 9.990e-58
Identity = 120/308 (38.96%), Postives = 165/308 (53.57%), Query Frame = 0
Query:   34 QDQTSARANTLLDDADDIQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLRRGKKGQK------KAETLKEWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARAGRKLVFKNYDVKPDAMKFINDGNRVTLIAKWK-NNTRPYIYGGAAHSRRYVFHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEE---ALQGSVSDPLAFLAVSTLYRYSNHTQE----GLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYACYQGSMTAPPCTEAVLWMIRGKTLPVTR 327
            QD  + R NTL DDADDIQRQLDNEARDR KYG PKTIW+ +FP            T P    + L  G    K        E + EWSY ++  W   FP CGG  QSP+++    +V  R  R L F N++ +P+ +   NDG ++ +  +W   N RP + GG  + R Y FHSL LHWPSEH +     P E+Q +H++  Y  + +   A    + +    L +S +YRYS+   E    GL D ++ A      D  L  +PLS + P F++YA Y+GS+  PPCT  V W++RG+   V R
Sbjct:   70 QDDATCRPNTLSDDADDIQRQLDNEARDRFKYGLPKTIWILNFP-----------FTTPVSVKRGLFHGCASSKCQTFDTSNEAIWEWSYPNECQWACHFPACGGPLQSPINLRLDNVVRERM-RPLDFHNWNQRPEELTLRNDGEKLVITGRWAGTNMRPAVSGGPLYRREYWFHSLHLHWPSEHAIDDGVLPFETQSVHVADGYCDLAQATNAFTAGLDNKSTVLIISNMYRYSDIRSELSDLGLLDSLRRAARGRRGDIPLPRRPLSFYVPRFQDYATYRGSVPFPPCTPCVTWVVRGRPRTVPR 365          
The following BLAST results are available for this feature:
BLAST of HiSeq13305 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909578202|ref|XP_013144952.1|6.274e-13353.13PREDICTED: carbonic anhydrase 3-like [Papilio poly... [more]
gi|910312682|ref|XP_013170990.1|3.152e-13152.84PREDICTED: carbonic anhydrase 1-like isoform X1 [P... [more]
gi|943978382|ref|XP_014370163.1|3.869e-12851.15PREDICTED: carbonic anhydrase 1-like [Papilio mach... [more]
gi|512892234|ref|XP_004922881.1|3.947e-12854.82PREDICTED: carbonic anhydrase 1-like [Bombyx mori][more]
gi|910312684|ref|XP_013170998.1|4.249e-12852.54PREDICTED: carbonic anhydrase 1-like isoform X2 [P... [more]
gi|930664874|gb|KPJ06005.1|3.901e-12752.41Carbonic anhydrase 6 [Papilio machaon][more]
gi|930661472|gb|KPJ03400.1|3.385e-12651.15Carbonic anhydrase 6 [Papilio xuthus][more]
gi|357628201|gb|EHJ77599.1|1.961e-10046.06putative carbonic anhydrase [Danaus plexippus][more]
gi|913330948|ref|XP_013197022.1|5.438e-7952.79PREDICTED: alpha carbonic anhydrase 8-like, partia... [more]
gi|768415969|ref|XP_011548555.1|9.990e-5838.96PREDICTED: carbonic anhydrase 15-like [Plutella xy... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 41..62
NoneNo IPR availablePANTHERPTHR18952:SF38PROTEIN CAH-6coord: 106..364
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..4
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 18..21
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 22..364
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..21
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 5..17
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.644
IPR001148Alpha carbonic anhydraseSMARTSM01057Carb_anhydrasecoord: 115..361
e-value: 5.5E-37
score: 138.9
IPR001148Alpha carbonic anhydrasePFAMPF00194Carb_anhydrasecoord: 115..358
e-value: 4.6E-28
score: 97.7
IPR001148Alpha carbonic anhydraseGENE3D3.10.200.10coord: 113..360
e-value: 3.8E-47
score: 160.7
IPR001148Alpha carbonic anhydrasePROSITEPS51144ALPHA_CA_2coord: 113..363
score: 39.069
IPR001148Alpha carbonic anhydraseSUPERFAMILY51069Carbonic anhydrasecoord: 114..361
IPR023561Carbonic anhydrase, alpha-classPANTHERPTHR18952CARBONIC ANHYDRASEcoord: 106..364

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13305HiSeq13305Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13305_p ID=HiSeq13305_p|Name=HiSeq13305|organism=Ostrinia scapulalis|type=polypeptide|length=364bp
MILNVVLISFISYSLLLSCNGRCTRATNFAEATQDQTSARANTLLDDADD
IQRQLDNEARDRIKYGRPKTIWVFHFPTQFPDINLVERATRPPRKVKFLR
RGKKGQKKAETLKEWSYKDQRTWPKIFPDCGGRSQSPVDVPYHGLVGARA
GRKLVFKNYDVKPDAMKFINDGNRVTLIAKWKNNTRPYIYGGAAHSRRYV
FHSLTLHWPSEHTVGGLQYPIESQVMHLSAEYNSMEEALQGSVSDPLAFL
AVSTLYRYSNHTQEGLNDLIKTAVASTTIDGCLTPKPLSHFSPPFKEYAC
YQGSMTAPPCTEAVLWMIRGKTLPVTRETVESARTLLGLPGEYGKVFFRS
TQPLNDRKAYYFKS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR023561Carbonic_anhydrase_a-class
IPR001148Carbonic_anhydrase_a