HiSeq13307_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13307
Unique NameHiSeq13307_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length300
Homology
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|768429962|ref|XP_011556184.1| (PREDICTED: thymidylate synthase-like [Plutella xylostella])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 244/289 (84.43%), Postives = 270/289 (93.43%), Query Frame = 0
Query:   12 KQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            K+H+EYQYL +V ++I++GDKRVDRTGVGTLS FG MQRYSL +N LPLLTTKRVF + VI ELLWMISGSTDAKALA KGVHIWDANGSR+FLDNLGFT R+EGDLGPVYGFQWRHSGA+Y+DA TDY+GQGIDQL+N+I+TLKKNPADRRMLMCAWNPSDL +MALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHIT L+AGEF+HT GDTHVYLNHI PL  QL REPRPFPTL+FARK++SIDDFK+EDFI++GYNPHPKIDMEMAV
Sbjct:    8 KEHDEYQYLKLVEQVIKSGDKRVDRTGVGTLSTFGAMQRYSLKDNTLPLLTTKRVFTRGVIEELLWMISGSTDAKALAAKGVHIWDANGSREFLDNLGFTDRKEGDLGPVYGFQWRHSGAKYVDASTDYTGQGIDQLQNVIDTLKKNPADRRMLMCAWNPSDLGQMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITGLEAGEFLHTTGDTHVYLNHIEPLKKQLEREPRPFPTLEFARKIDSIDDFKYEDFIIKGYNPHPKIDMEMAV 296          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|768425367|ref|XP_011553679.1| (PREDICTED: thymidylate synthase-like [Plutella xylostella])

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 245/289 (84.78%), Postives = 269/289 (93.08%), Query Frame = 0
Query:   12 KQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            K+H+EYQYL +V ++I+ GDKRVDRTGVGTLSIFG MQRYSL +N LPLLTTKRVF + VI ELLWMISGSTDAKALA KGVHIWDANGSR+FLDNLGFT R+EGDLGPVYGFQWRHSGA+Y+DA TDY+GQGIDQL+N+I+TLKKNPADRRMLMCAWNPSDL +MALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHIT L+AGEFVHT GDTHVYLNHI PL  QL REPRPFPTL+FARK++SID FK+EDFI++GYNPHPKIDMEMAV
Sbjct:    8 KEHDEYQYLKLVEQVIKLGDKRVDRTGVGTLSIFGAMQRYSLKDNTLPLLTTKRVFTRGVIEELLWMISGSTDAKALAAKGVHIWDANGSREFLDNLGFTDRKEGDLGPVYGFQWRHSGAKYVDATTDYTGQGIDQLQNVIDTLKKNPADRRMLMCAWNPSDLGQMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITGLEAGEFVHTTGDTHVYLNHIEPLKKQLEREPRPFPTLEFARKIDSIDGFKYEDFIIKGYNPHPKIDMEMAV 296          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|913310179|ref|XP_013185715.1| (PREDICTED: thymidylate synthase [Amyelois transitella])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 241/291 (82.82%), Postives = 268/291 (92.10%), Query Frame = 0
Query:   10 TPKQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            +  +HEEYQYL IV+KII++GDKRVDRTGVGTLSIFG MQRYSL NN LPLLTTKRVF + VI+ELLWM+SGSTD KALAEKGVHIWDANGSR FLDNLGFT REEGDLGPVYGFQWRHSGA+Y+DAKTDY+GQGIDQ++ +I+T++ NP DRRML+CAWNPSDL +MALPPCHCLAQFHVASG+L+CLLYQRSADMGLGVPFNIASYA+LTHMIAHIT L+AG+FVHT GDTHVYL HI PLT QL REPRPFPTLKF RK+ESIDDFKFEDFI+EGY PHPKI+MEMAV
Sbjct:    7 SASEHEEYQYLQIVQKIIDSGDKRVDRTGVGTLSIFGAMQRYSLKNNTLPLLTTKRVFTRGVIYELLWMLSGSTDTKALAEKGVHIWDANGSRSFLDNLGFTDREEGDLGPVYGFQWRHSGAKYVDAKTDYTGQGIDQIQKVIDTIRTNPTDRRMLVCAWNPSDLNQMALPPCHCLAQFHVASGRLNCLLYQRSADMGLGVPFNIASYAMLTHMIAHITGLEAGDFVHTTGDTHVYLTHIAPLTEQLKREPRPFPTLKFTRKIESIDDFKFEDFIIEGYKPHPKIEMEMAV 297          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|509164879|gb|JAA80560.1| (thymidylate synthase isoform 1 [Pararge aegeria])

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 240/293 (81.91%), Postives = 266/293 (90.78%), Query Frame = 0
Query:    8 ENTPKQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            E +   HEE QYL++V+ IIE GDKR+DRTGVGTLSI G MQRYSL NNILPLLTTKRVF + VI ELLWMISGST++K LA KGVHIWD+NGSR FLD LGFT REEGDLGPVYGFQWRHSGA+YIDAKTDY+GQGIDQL+N+I+T+K NP+DRR+LMCAWNPSDL KMALPPCHCLAQFHVA+GKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNL+AGEFVHT GDTHVYLNHI PL  QL REPRPFPTL+FAR ++SIDDFK+EDFI++ YNP+PKIDMEMAV
Sbjct:    7 EKSLSPHEESQYLNLVKTIIEKGDKRIDRTGVGTLSILGAMQRYSLNNNILPLLTTKRVFARGVIEELLWMISGSTNSKVLASKGVHIWDSNGSRAFLDKLGFTEREEGDLGPVYGFQWRHSGAKYIDAKTDYTGQGIDQLQNVIDTIKNNPSDRRILMCAWNPSDLSKMALPPCHCLAQFHVANGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLEAGEFVHTTGDTHVYLNHIEPLKKQLEREPRPFPTLEFARNIDSIDDFKYEDFIIKNYNPYPKIDMEMAV 299          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|910342557|ref|XP_013175014.1| (PREDICTED: thymidylate synthase [Papilio xuthus])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 233/288 (80.90%), Postives = 264/288 (91.67%), Query Frame = 0
Query:   13 QHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
             H+EYQYL +V++II+ GDKR+DRT VGTLS+FG MQRYSL NNILPLLTTKRVF + VI ELLWMISGSTD+K LA+KGVHIWDANGSR FLDNLGFT REEGDLGPVYGFQWRHSGA+YIDAKTDY+ QGIDQL+N+I T+K NPADRRM+MCAWNPSDL +MALPPCHCL QFHVA+GKL+CL+YQRSADMGLGVPFNIASY+LLTHMIAH+T L+AGEFVHT GDTHVYLNHI PL  QL R+P+PFPTL+FARKVE+IDDFK+EDFI++ YNPHPKI+MEMAV
Sbjct:    9 NHDEYQYLKLVKEIIDKGDKRIDRTCVGTLSVFGAMQRYSLRNNILPLLTTKRVFTRGVIEELLWMISGSTDSKVLAQKGVHIWDANGSRAFLDNLGFTDREEGDLGPVYGFQWRHSGAKYIDAKTDYTNQGIDQLQNVINTIKNNPADRRMIMCAWNPSDLSQMALPPCHCLVQFHVANGKLNCLMYQRSADMGLGVPFNIASYSLLTHMIAHVTGLEAGEFVHTTGDTHVYLNHIEPLQKQLERKPKPFPTLEFARKVETIDDFKYEDFIIKNYNPHPKIEMEMAV 296          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|357624083|gb|EHJ74987.1| (thymidylate synthase isoform 1 [Danaus plexippus])

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 232/288 (80.56%), Postives = 266/288 (92.36%), Query Frame = 0
Query:   13 QHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            QH+EYQYL+++R II+TGDKR DRTGVGTLS+FG++QRYSL NN LPLLTTKRVF++ VI ELLWMISGSTD+K LA KGVHIWDANGSR FLDNLGF  REEGDLGPVYGFQWRHSGA+YIDAKTDY+GQG+DQL+N+I+T+KKNP DRR++MCAW P+DL  MALPPCHCLAQF+V++GKLSCLLYQRSADMGLGVPFNIASY+LLTHMIAHITNL+AGEFVHT GDTHVYLNHI PL  QL REPRPFPTL+F RK++SIDDFK+EDF+V+ YNP+PKIDME+AV
Sbjct:   10 QHDEYQYLNLIRDIIKTGDKRNDRTGVGTLSVFGSVQRYSLKNNTLPLLTTKRVFVRGVIEELLWMISGSTDSKKLASKGVHIWDANGSRAFLDNLGFKDREEGDLGPVYGFQWRHSGAKYIDAKTDYTGQGVDQLQNVIDTIKKNPGDRRIIMCAWIPADLSLMALPPCHCLAQFYVSNGKLSCLLYQRSADMGLGVPFNIASYSLLTHMIAHITNLEAGEFVHTTGDTHVYLNHIEPLNKQLEREPRPFPTLEFKRKIDSIDDFKYEDFVVKNYNPYPKIDMELAV 297          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|943958234|ref|XP_014361831.1| (PREDICTED: thymidylate synthase [Papilio machaon] >gi|930671823|gb|KPJ12517.1| Thymidylate synthase [Papilio machaon])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 231/288 (80.21%), Postives = 263/288 (91.32%), Query Frame = 0
Query:   13 QHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
             H+EYQYL +V++II+ GDKR+DRT VGTLS+FG MQRYSL N  LPLLTTKRVF + VI ELLWMISGSTD+K LAEKG+HIWDANGSR FLDNLGFT+REEGDLGPVYGFQWRHSGA+Y+DAKTDY+ QGIDQL+N+I+T+K NPADRRM+MCAWNPSDL +MALPPCHCL QFHVA GKL+CL+YQRSADMGLGVPFNIASY+LLTHMIAH+T L+AGEFVHT GDTHVYLNHI PL  QL R+P+PFPTL+FARKVESIDDFK+EDFI++ YNPHPKI+MEMAV
Sbjct:    9 NHDEYQYLKLVKEIIDKGDKRIDRTCVGTLSVFGAMQRYSLKNKTLPLLTTKRVFTRGVIEELLWMISGSTDSKVLAEKGIHIWDANGSRAFLDNLGFTNREEGDLGPVYGFQWRHSGAKYVDAKTDYTNQGIDQLQNVIKTIKNNPADRRMIMCAWNPSDLSQMALPPCHCLVQFHVADGKLNCLMYQRSADMGLGVPFNIASYSLLTHMIAHVTGLEAGEFVHTTGDTHVYLNHIEPLQKQLERKPKPFPTLEFARKVESIDDFKYEDFIIKNYNPHPKIEMEMAV 296          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|114053279|ref|NP_001040281.1| (thymidylate synthase isoform 1 [Bombyx mori] >gi|87248619|gb|ABD36362.1| thymidylate synthase isoform 1 [Bombyx mori])

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 233/289 (80.62%), Postives = 264/289 (91.35%), Query Frame = 0
Query:   12 KQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            K H+EYQYL ++ +II++GDKRVDRTGVGTLSIFG MQRYSL NN LPLLTTKRVF + VI ELLWMISGSTD+KALA KGVHIWDANGSR+FLDNLGFT REEGDLGPVYGFQWRHSGA+YID +TDY+GQGIDQL+++I+++K NPADRRML+CAWN SDL+KMALPPCHCLAQF+VA GKLSCLLYQRSADMGLGVPFNIASY+LLTHMIAH+T  QAGEF+HT GDTHVYLNHI PL  QL REP+ FPTL+FARK+ESIDDFK+EDFI++ Y PHPKI+MEMAV
Sbjct:   10 KSHDEYQYLKLIDQIIKSGDKRVDRTGVGTLSIFGAMQRYSLHNNTLPLLTTKRVFTRGVIEELLWMISGSTDSKALAAKGVHIWDANGSRNFLDNLGFTDREEGDLGPVYGFQWRHSGAKYIDCQTDYTGQGIDQLQSVIDSIKNNPADRRMLICAWNSSDLKKMALPPCHCLAQFYVADGKLSCLLYQRSADMGLGVPFNIASYSLLTHMIAHVTGYQAGEFIHTTGDTHVYLNHIEPLKIQLQREPKQFPTLEFARKIESIDDFKYEDFIIKDYKPHPKIEMEMAV 298          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|909560188|ref|XP_013135175.1| (PREDICTED: thymidylate synthase [Papilio polytes])

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 228/288 (79.17%), Postives = 262/288 (90.97%), Query Frame = 0
Query:   13 QHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            +H+EYQYL++V++II+ GDKR+DRT VGTLSIFG MQRYSL NN LPLLTTKRVF + VI ELLWMISGSTD+K LAEK VHIWDANGSR+FLDNLGFT REEGDLGPVYGFQWRHSGA+Y++AKTDY+ QGIDQL+N+I T+K NPADRRM+MCAWNPSDL +MALPPCHCL QFHV  GKL+CL+YQRSADMGLGVPFNIASY+ LTHMIAH+T L+AGEFVHT GDTH+YLNHI PL  QL R+P+PFPTL+FARK+ESIDDFK+EDFI++ YNPHPKI+MEMAV
Sbjct:    9 KHDEYQYLNLVKEIIDRGDKRIDRTRVGTLSIFGAMQRYSLQNNSLPLLTTKRVFTRGVIEELLWMISGSTDSKVLAEKEVHIWDANGSREFLDNLGFTDREEGDLGPVYGFQWRHSGAKYVNAKTDYTNQGIDQLQNVINTIKNNPADRRMIMCAWNPSDLSQMALPPCHCLVQFHVEDGKLNCLMYQRSADMGLGVPFNIASYSFLTHMIAHVTGLEAGEFVHTTGDTHIYLNHIEPLKKQLERKPKPFPTLEFARKIESIDDFKYEDFIIKNYNPHPKIEMEMAV 296          
BLAST of HiSeq13307 vs. genbank:protein
Match: gi|914543022|gb|KOB55697.1| (Thymidylate synthase isoform 1 [Operophtera brumata])

HSP 1 Score: 507.294 bits (1305), Expect = 2.925e-180
Identity = 235/287 (81.88%), Postives = 258/287 (89.90%), Query Frame = 0
Query:   14 HEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQRYSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANGSRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKNIIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLYQRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHITPLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV 300
            H+E QYL++V +II+TGDKRVDRTGVG LSIFG MQRYSL NNILPLLTTKRVF++ VI ELLWMISGSTD+KALA KGVHIWDANGSR FLDNLGFT REEGDLGPVYGFQWRHSGAQY+D+KTDY+GQGIDQL+NIIET++KNPADRRMLMCAWNPSDL KMALPPCHCLAQFHVASGKLSC+LYQRSADMGLGVPFNIASY+LLTHMIAHIT           GDTHVYLNHI PL  Q+ R P+PFPTL+FARK+ESIDDFK+EDFI++ Y PHPKIDMEMAV
Sbjct:   10 HDELQYLNLVEQIIKTGDKRVDRTGVGALSIFGAMQRYSLKNNILPLLTTKRVFIRGVIEELLWMISGSTDSKALAAKGVHIWDANGSRSFLDNLGFTDREEGDLGPVYGFQWRHSGAQYVDSKTDYTGQGIDQLQNIIETIRKNPADRRMLMCAWNPSDLNKMALPPCHCLAQFHVASGKLSCILYQRSADMGLGVPFNIASYSLLTHMIAHIT-----------GDTHVYLNHIDPLKQQILRVPKPFPTLEFARKIESIDDFKYEDFIIKDYKPHPKIDMEMAV 285          
The following BLAST results are available for this feature:
BLAST of HiSeq13307 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|768429962|ref|XP_011556184.1|0.000e+084.43PREDICTED: thymidylate synthase-like [Plutella xyl... [more]
gi|768425367|ref|XP_011553679.1|0.000e+084.78PREDICTED: thymidylate synthase-like [Plutella xyl... [more]
gi|913310179|ref|XP_013185715.1|0.000e+082.82PREDICTED: thymidylate synthase [Amyelois transite... [more]
gi|509164879|gb|JAA80560.1|0.000e+081.91thymidylate synthase isoform 1 [Pararge aegeria][more]
gi|910342557|ref|XP_013175014.1|0.000e+080.90PREDICTED: thymidylate synthase [Papilio xuthus][more]
gi|357624083|gb|EHJ74987.1|0.000e+080.56thymidylate synthase isoform 1 [Danaus plexippus][more]
gi|943958234|ref|XP_014361831.1|0.000e+080.21PREDICTED: thymidylate synthase [Papilio machaon] ... [more]
gi|114053279|ref|NP_001040281.1|0.000e+080.62thymidylate synthase isoform 1 [Bombyx mori] >gi|8... [more]
gi|909560188|ref|XP_013135175.1|0.000e+079.17PREDICTED: thymidylate synthase [Papilio polytes][more]
gi|914543022|gb|KOB55697.1|2.925e-18081.88Thymidylate synthase isoform 1 [Operophtera brumat... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006231 dTMP biosynthetic process
biological_process GO:0046078 dUMP metabolic process
biological_process GO:0032259 methylation
biological_process GO:0006417 regulation of translation
biological_process GO:0035999 tetrahydrofolate interconversion
cellular_component GO:0005743 mitochondrial inner membrane
cellular_component GO:0005759 mitochondrial matrix
cellular_component GO:0005730 nucleolus
molecular_function GO:0048037 cofactor binding
molecular_function GO:0008144 drug binding
molecular_function GO:0005542 folic acid binding
molecular_function GO:0003729 mRNA binding
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0042803 protein homodimerization activity
molecular_function GO:0004799 thymidylate synthase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000398Thymidylate synthasePRINTSPR00108THYMDSNTHASEcoord: 151..170
score: 52.02
coord: 195..221
score: 82.74
coord: 177..192
score: 66.89
coord: 233..250
score: 59.69
coord: 58..79
score: 62.86
IPR000398Thymidylate synthasePFAMPF00303Thymidylat_syntcoord: 16..300
e-value: 1.4E-121
score: 404.5
IPR000398Thymidylate synthaseTIGRFAMTIGR03284TIGR03284coord: 18..300
e-value: 1.3E-101
score: 337.7
IPR000398Thymidylate synthaseHAMAPMF_00008Thymidy_synth_bactcoord: 16..300
score: 40.81
IPR023451Thymidylate synthase/dCMP hydroxymethylase domainGENE3D3.30.572.10coord: 11..300
e-value: 5.5E-141
score: 468.2
IPR023451Thymidylate synthase/dCMP hydroxymethylase domainSUPERFAMILY55831Thymidylate synthase/dCMP hydroxymethylasecoord: 11..300
NoneNo IPR availablePANTHERPTHR11549DIHYDROFOLATE REDUCTASEcoord: 4..300
NoneNo IPR availablePANTHERPTHR11549:SF2THYMIDYLATE SYNTHASEcoord: 4..300
IPR020940Thymidylate synthase, active sitePROSITEPS00091THYMIDYLATE_SYNTHASEcoord: 162..190

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13307HiSeq13307Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13307_p ID=HiSeq13307_p|Name=HiSeq13307|organism=Ostrinia scapulalis|type=polypeptide|length=300bp
MGIVTLHENTPKQHEEYQYLDIVRKIIETGDKRVDRTGVGTLSIFGTMQR
YSLTNNILPLLTTKRVFLKAVIHELLWMISGSTDAKALAEKGVHIWDANG
SRDFLDNLGFTSREEGDLGPVYGFQWRHSGAQYIDAKTDYSGQGIDQLKN
IIETLKKNPADRRMLMCAWNPSDLRKMALPPCHCLAQFHVASGKLSCLLY
QRSADMGLGVPFNIASYALLTHMIAHITNLQAGEFVHTMGDTHVYLNHIT
PLTTQLTREPRPFPTLKFARKVESIDDFKFEDFIVEGYNPHPKIDMEMAV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003729mRNA binding
GO:0042803protein homodimerization activity
GO:0005542folic acid binding
GO:0000166nucleotide binding
GO:0008144drug binding
GO:0048037cofactor binding
GO:0004799thymidylate synthase activity
Vocabulary: Biological Process
TermDefinition
GO:0032259methylation
GO:0006417regulation of translation
GO:0035999tetrahydrofolate interconversion
GO:0046078dUMP metabolic process
GO:0006231dTMP biosynthetic process
Vocabulary: Cellular Component
TermDefinition
GO:0005730nucleolus
GO:0005743mitochondrial inner membrane
GO:0005759mitochondrial matrix
Vocabulary: INTERPRO
TermDefinition
IPR020940Thymidylate_synthase_AS
IPR023451Thymidate_synth/dCMP_Mease
IPR000398Thymidylate_synthase