HiSeq13318_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13318
Unique NameHiSeq13318_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length462
Homology
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|512907882|ref|XP_004926553.1| (PREDICTED: retinoid-inducible serine carboxypeptidase-like [Bombyx mori])

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 264/433 (60.97%), Postives = 331/433 (76.44%), Query Frame = 0
Query:    2 AAGIGVLIWWLVADHSDNGNGEIDNTWLEGIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGL---DKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGI-SEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRI 430
            AA IG LIWWLV D  +    +++   +  I  TA F  I   G +FWWF+P+L +    +P+ILW+DGVTG PPSLLANFGMFGP+DFNL +RNDSW+++YNLLFVDAPLGTGFST  SD +IPGNLD  T+HLL  LESFY  HE++ DTPLYI G+G+GAQ+A++L   L   D       NLKG+V+GNGI+SPA+ALTKLGFYLEELGYID NGRAAIE  S + +  VS GQL +A++KF++LG+FVNE+AGAVAVNLGHIV+K+T + A++D FGQ++Y+++   F +D  +FM E VAPALGI S+  FD +R  V+ AF++ FM PA   VE +L NT+L V IYNGNLDAVSNTPGQLEWVDNL+W GQ EF  + R+TL++N L+EGYFRET +L FYWMNAAG SVPLDS + MRRI+ RI
Sbjct:   19 AAVIGFLIWWLVTDTEEFTIIKLEGEGIGDIEYTAAFTRIRGSGDIFWWFYPTLPAVKIIKPIILWVDGVTGVPPSLLANFGMFGPYDFNLNQRNDSWINNYNLLFVDAPLGTGFSTAQSDSQIPGNLDATTDHLLFTLESFYRLHEDYADTPLYIFGEGHGAQIALALARRLASTDPPGRFQHNLKGVVLGNGIVSPALALTKLGFYLEELGYIDANGRAAIETLSEDVSSSVSGGQLRDAFDKFITLGDFVNEKAGAVAVNLGHIVDKLTRE-ASRDYFGQRQYMQE--KFGLDAFSFMQETVAPALGIPSDVSFDYNRAAVVDAFRNNFMAPATPHVEFLLRNTDLKVVIYNGNLDAVSNTPGQLEWVDNLQWPGQEEFKTTPRRTLVINRLVEGYFRETPRLSFYWMNAAGQSVPLDSPLAMRRILDRI 448          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|1073542923|gb|JAT88573.1| (hypothetical protein g.11280 [Pectinophora gossypiella])

HSP 1 Score: 514.998 bits (1325), Expect = 6.119e-178
Identity = 255/436 (58.49%), Postives = 327/436 (75.00%), Query Frame = 0
Query:    1 VAAGIGVLIWWLVADHSDNGNGEIDNTWLEG-----IPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDS-ATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGISEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRI 430
            VAAG+GVLIWWLVA    N         LEG     +  TA +  I   G MFWWF+P+ A   ++RPLILWLDGVTG  PSLLANFGM GP DFNL  RN SWV+D N+LFVDAPLGTGFS    + ++P N+D NT+HLL  LESFY+  E++ D+PLYI GQG GA LA++L + L K  + + NLKG+VIGNG++SPA+ALT+LGFYL+E+GY+D  GR  ++ FS E + LV  GQ  EA++KFL+LG+F+NEEAG VAVNL +I++K+T  S A +D FGQ++YLR     ++DFN FM + +APALGIS P +D  RE VI+AF++ +M+P   +VE +L NT ++VTIYNGNLDAVS TPGQL+WV+NL+W+GQ EF  ++R+TLIVN L+EGYFRETD+L FYWMNAAG+SVPLDS   MRR++QRI
Sbjct:   17 VAAGLGVLIWWLVAGRHPN----FTTVLLEGEGFRDVQQTAAWTRIRGTGDMFWWFYPTTAGAQAARPLILWLDGVTGLSPSLLANFGMIGPLDFNLNARNGSWVEDCNVLFVDAPLGTGFSRANGNNDLPQNIDDNTDHLLYTLESFYSAREDYQDSPLYIFGQGDGAPLALALAIRLAKGVSFSHNLKGVVIGNGVVSPALALTELGFYLDEMGYVDPAGRVIVKAFSEELSALVDGGQFEEAFDKFLTLGDFLNEEAGTVAVNLNYIIQKLTRTSTAARDYFGQREYLRSALQTDIDFNQFMVQTIAPALGISSPFYDESREAVIRAFRETYMQPTTELVEYLLNNTEVSVTIYNGNLDAVSTTPGQLKWVNNLQWAGQAEFRNTNRRTLIVNSLVEGYFRETDRLAFYWMNAAGISVPLDSPTAMRRVMQRI 448          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|1073543497|gb|JAT88860.1| (hypothetical protein g.11279 [Pectinophora gossypiella] >gi|1073544087|gb|JAT89155.1| hypothetical protein g.11281 [Pectinophora gossypiella])

HSP 1 Score: 491.886 bits (1265), Expect = 5.806e-169
Identity = 245/421 (58.19%), Postives = 315/421 (74.82%), Query Frame = 0
Query:    1 VAAGIGVLIWWLVADHSDNGNGEIDNTWLEG-----IPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDS-ATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGISEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSV 415
            VAAG+GVLIWWLVA    N         LEG     +  TA +  I   G MFWWF+P+ A   ++RPLILWLDGVTG  PSLLANFGM GP DFNL  RN SWV+D N+LFVDAPLGTGFS    + ++P N+D NT+HLL  LESFY+  E++ D+PLYI GQG GA LA++L + L K  + + NLKG+VIGNG++SPA+ALT+LGFYL+E+GY+D  GR  ++ FS E + LV  GQ  EA++KFL+LG+F+NEEAG VAVNL +I++K+T  S A +D FGQ++YLR     ++DFN FM + +APALGIS P +D  RE VI+AF++ +M+P   +VE +L NT ++VTIYNGNLDAVS TPGQL+WV+NL+W+GQ EF  ++R+TLIVN L+EGYFRETD+L FYWMNAAG+SV
Sbjct:   17 VAAGLGVLIWWLVAGRHPN----FTTVLLEGEGFRDVQQTAAWTRIRGTGDMFWWFYPTTAGAQAARPLILWLDGVTGLSPSLLANFGMIGPLDFNLNARNGSWVEDCNVLFVDAPLGTGFSRANGNNDLPQNIDDNTDHLLYTLESFYSAREDYQDSPLYIFGQGDGAPLALALAIRLAKGVSFSHNLKGVVIGNGVVSPALALTELGFYLDEMGYVDPAGRVIVKAFSEELSALVDGGQFEEAFDKFLTLGDFLNEEAGTVAVNLNYIIQKLTRTSTAARDYFGQREYLRSALQTDIDFNQFMVQTIAPALGISSPFYDESREAVIRAFRETYMQPTTELVEYLLNNTEVSVTIYNGNLDAVSTTPGQLKWVNNLQWAGQAEFRNTNRRTLIVNSLVEGYFRETDRLAFYWMNAAGISV 433          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|913313168|ref|XP_013187348.1| (PREDICTED: serine carboxypeptidase-like 51 [Amyelois transitella])

HSP 1 Score: 466.848 bits (1200), Expect = 4.544e-159
Identity = 236/440 (53.64%), Postives = 313/440 (71.14%), Query Frame = 0
Query:    4 GIGVLIWWLVADHSDNGNGEIDNTWLEG-----IPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAE-NSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATK---DIFGQKKYLRDVTGFNVDFNTFMTERVAPALGISEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRIVDSD 434
            G+ VLIWWLV  +    +GEI    LEG     + ++A F  I   G +FW F+P+    +++RP+IL+LDGVTG PPSL ANFGMFGP D NL +R DSWVD YNLLF DAP+GTGFSTI  +  IP  L+ + + L   LESFY RH  +   PLYI+G+G+GAQLA+ L   L K + N   NL+G++IGNGI+SPA+AL+KLGFYLEELGYIDG GR  IE FS+E   LVS+    +A+E+FL+LGE VN+ AGA+AVNLG+I++K+T +  +    + FG + YL+  +    +   FM + VAPALGIS   +DS RE  + +F+ + M P+  +VE +L+NTN+TV+IYNGNLDAVSNTPGQLEW++NL WSG+ EF  S+RQTL+V+ L++GYF+ET KLKFYW+N AGVSVP DS   MR ++ RI  ++
Sbjct:   20 GLSVLIWWLVTRN----DGEITVIDLEGEGFDGVSHSAGFTSIQGTGDLFWLFYPTTNFSSTNRPIILFLDGVTGIPPSLWANFGMFGPLDINLNRREDSWVDSYNLLFFDAPMGTGFSTIERENRIPRTLEGHADLLASNLESFYNRHRTYSSAPLYIMGEGHGAQLALGLAEKLTKPDLNFEHNLQGVIIGNGIVSPALALSKLGFYLEELGYIDGRGRETIETFSSEINTLVSDENYDDAFEQFLTLGEIVNDNAGAIAVNLGYIIQKLTREETSSRNFNAFGMRSYLQKASRAQ-NLYEFMEDTVAPALGISNVAYDSSRETALNSFRSILMVPSVEIVEHLLQNTNVTVSIYNGNLDAVSNTPGQLEWINNLVWSGRFEFDNSTRQTLVVDRLVQGYFKETAKLKFYWINVAGVSVPYDSRRAMRIVLNRIFGTN 454          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|357611248|gb|EHJ67387.1| (hypothetical protein KGM_01563 [Danaus plexippus])

HSP 1 Score: 436.417 bits (1121), Expect = 3.145e-142
Identity = 222/430 (51.63%), Postives = 294/430 (68.37%), Query Frame = 0
Query:    2 AAGIGVLIWWLVA-DHSDNGNGEIDNTWLEGIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIAS-DVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGIS-EPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQ 428
             AG+GVLIWWLV+ D       E+    +  +  TA F  +   G +FWWF+P+LA   + RPL+LW  GVTG P S LANFGMFGP+D +L KRNDS V+DYNLLFVDA +GTGFST  S D ++P +LD N E L + L+SFY  H E+ ++P+Y+   G G+QL + LV  L   +N +  +KG+++GN +ISPA+ALTKLG+YLEEL YIDG GR  IE FSN T  LV       A+++F S+  FVN+ AGAV+VNL +IVEK+T +S  +D FGQ  Y+  + G + + + FM   V PALGIS E  +D  RE+ IQAFK  +M+P  + VE IL  TN+ VTIYNGNLDAVSNTPGQ EW+  L W GQ EFL  +R+ +++NGL+EGY R TDKL+FYW+N AG+ VPL++ V  + ++ 
Sbjct:  397 VAGLGVLIWWLVSSDDPPYETIELKGENIGNVSYTAAFTRVRGKGDVFWWFYPTLAETPTKRPLLLWFHGVTGLPASFLANFGMFGPYDVHLTKRNDSLVNDYNLLFVDASIGTGFSTAESEDRDLP-SLDENVESLWRMLQSFYDVHNEYRESPIYLCSMGDGSQLVIPLVTKLAMEDNVSDQIKGVILGNPVISPALALTKLGYYLEELAYIDGRGRTEIESFSNLTYSLVQSESFERAFDQFSSIDNFVNDNAGAVSVNLNYIVEKLTRES-NRDYFGQNNYVNRILGLSQNASVFMDTVVRPALGISNEIRYDGQREKAIQAFKSSYMKPIVHAVEHILNETNVNVTIYNGNLDAVSNTPGQWEWIRTLNWQGQEEFLNQTRRPMVLNGLLEGYSRITDKLRFYWINVAGLMVPLENPVAFKSLLH 824          

HSP 2 Score: 216.083 bits (549), Expect = 1.223e-58
Identity = 127/392 (32.40%), Postives = 210/392 (53.57%), Query Frame = 0
Query:   47 MFWWFFPSLA--SEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENS---TANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEK----VTYDSATKDI------FGQKKYLRDVTGFNVDFNTFMTERVAPALGI-SEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVG 422
            MF+W + + A  S  + RPLI+WL G  G   + + NF + GP D NL++RN +WV+++N++FVD P+GTGFS +   + +    D      ++ ++ FY  + EF + PLYI GQ YG ++A+ + + + +AE +    +NL+GI +GN  ISP  +    G  L   G +D  G   I+  + ET  L +EG    A  ++ +    V +      V+  +I+ K     T+D+  + +      +G+ +  R+        NT M  RV  ALGI +   + +    V  A +  FM+P    +E++L  T++ +T YNGNLD + +T GQ+ WVD L W G   +  ++R  + +N  +EGY++     +F+W+N AG SVP D+  G
Sbjct:    1 MFYWMYYTTANVSNHTERPLIVWLQGGPGGSSTGIGNFEILGPLDENLQERNYTWVNNFNVIFVDNPVGTGFSYVDDPIYLTTTNDQIALDFVELMKGFYRSNPEFEEVPLYIYGQSYGGKMAIDMGIRMREAEIAGTIKSNLRGIAMGNAWISPVDSTLTWGPLLLAAGLVDQTGYEQIQTSARETQRLFNEGLYLGATAQWSATQTAVLQ--ATTRVDFYNILTKNPVPQTFDNELEKLMLPDSFYGKSRRSRNT------LNTLMNTRVKEALGIPANVTWSALSNSVFHALRTDFMKPVTENIEKLLNETDIIITKYNGNLDLICSTTGQILWVDRLRWQGAEGYKNATRHPIWINNRLEGYYKSYRNFRFFWINLAGHSVPRDNPAG 384          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|943976561|ref|XP_014369392.1| (PREDICTED: retinoid-inducible serine carboxypeptidase-like [Papilio machaon])

HSP 1 Score: 390.193 bits (1001), Expect = 3.341e-129
Identity = 194/404 (48.02%), Postives = 272/404 (67.33%), Query Frame = 0
Query:   31 GIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGIS-EPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRIVDS 433
            G  +TA F  I  VG +FW F+PSL  ++++RPLI+WLDGVTG PPSL ANF MFGPF  NL +R DSWV+ +NLL +DAP+GTG+S    +  I  N + + + L+  L+SFY  H+E+ +TP+Y+ GQG+GAQ A++L   + +       +KG+ IGNGIISPA+ALTK+GFYLEE G ID +GR  +E +S++   L + G+  EA++ FLS+ + +N  AGA  +NL  I EK+T D   ++ F ++         + +    M E V P LG+S    +D  RE V++AF+  FM+PA   VE +L+NTN++VTIYNGNLDA+SNTPGQL WVDNL WSGQ +FL   R+  + +  ++GY+R+T +L FYWMN+ G SVPLD   GM RI+Q I ++
Sbjct:   37 GFKHTAAFTRISGVGDLFWLFWPSLVDDSTTRPLIVWLDGVTGVPPSLRANFEMFGPFGTNL-RRQDSWVNYFNLLLIDAPVGTGYSKAEDENNISTNFEDHVDDLVSVLKSFYEIHKEYTNTPVYVFGQGHGAQFAVALAARIAEKSQFNNVIKGVGIGNGIISPALALTKIGFYLEEFGKIDSDGRRVVENYSDKINRLTNNGRYGEAFDLFLSIKKVINVNAGAAGINLDDIAEKLTRDK-LQEYFNRR--------LSAEQYRLMEETVPPLLGLSGNVVYDEQREAVLKAFRSSFMKPAVEKVEYLLQNTNISVTIYNGNLDAISNTPGQLLWVDNLRWSGQKDFLNDERKPFVRSHGLQGYYRKTSRLHFYWMNSVGQSVPLDGYYGMTRILQIITNT 430          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|910313680|ref|XP_013176782.1| (PREDICTED: retinoid-inducible serine carboxypeptidase-like [Papilio xuthus])

HSP 1 Score: 377.867 bits (969), Expect = 1.782e-124
Identity = 196/412 (47.57%), Postives = 277/412 (67.23%), Query Frame = 0
Query:   23 EIDNTWLEGIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGIS-EPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRIVDS 433
            ++  T   G  +TA F  I  VG +FW F+PSLA ++++RPLI+WLDGVTG PPSL ANF MFGPF  +L +R DSW+  +NLL +DAP+GTG+S    +  I  N + + ++L+  L+SFY  H+E+ +  +Y+ GQG+GAQLA++L   L +       +KG+ IGNGIISPA+ALTK+GFYLEE G ID +GR  +E +SN+   L + G+  EA++ FLS+ + +N +AGA  +NL  I EK+T D   +D F ++         + +    M E V P LG+S +  +D  RE V++AF+  FM+P+   VE +L+NTN++VTIYNGNLDA+SNTPGQL WVDNL WSGQ +FL   R+  + +  ++GYFR T +L+FYWMN+ G SVPLD   GM RI+Q I ++
Sbjct:   29 KLQGTGFNGYKHTAAFTRISGVGDLFWLFWPSLADDSTTRPLIVWLDGVTGVPPSLRANFEMFGPFGTDL-RRQDSWIKYFNLLLIDAPVGTGYSKAEDENNISTNFEDHVDNLVSVLKSFYETHKEYTNAAVYVFGQGHGAQLAVALAARLAEKNQLNNVVKGVGIGNGIISPALALTKIGFYLEEFGKIDADGRRVVENYSNKINRLTNNGRFGEAFDLFLSIKKVINVDAGAAGLNLDDISEKLTRDK-LQDYFNRR--------LSAEQYRLMEETVPPLLGLSGKVIYDGQREAVLKAFRSSFMKPSVEKVEFLLQNTNISVTIYNGNLDAISNTPGQLLWVDNLRWSGQNDFLNDVRKPFVRSRGLQGYFRRTSRLQFYWMNSVGQSVPLDGYYGMTRILQIITNT 430          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|909574423|ref|XP_013142909.1| (PREDICTED: retinoid-inducible serine carboxypeptidase-like [Papilio polytes])

HSP 1 Score: 368.622 bits (945), Expect = 9.141e-121
Identity = 197/403 (48.88%), Postives = 274/403 (67.99%), Query Frame = 0
Query:   32 IPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGIS-EPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRIVDS 433
            + +T  F +I  VG++FW F+PSLA  + ++PLI+WLDGVTG PPSL ANF MFGPF  NL +R +SW+  +NLL +DAP+GTG+S    +  I  N + + ++L+  L+SFY  HEE+ +TP+YI GQG+GAQLA++L   L +       +KG+ IGNGIISPA ALTK+GFYLEE G ID +GR  +E FS+E   L + G+  EA++ FLS+ + VN  AGA  +NL  I EK+T D        Q+ + R +T    D    M E V P +G+S +  +D  R+ V++AF++  M+PA + VE +L+NTN++VTIYNGNLDA+SNTPGQL WVDNL WSGQ +FL   R+  + +  ++GY+R+T +L FYWMN+ G SVPLD   GM RI+Q I ++
Sbjct:   38 VAHTVAFTKISGVGELFWLFWPSLAEYSPNQPLIVWLDGVTGVPPSLRANFEMFGPFGTNL-RRQESWIQYFNLLLIDAPVGTGYSKAEDENNISTNFEDHVDNLVTILKSFYGIHEEYSNTPVYIFGQGHGAQLAVALAARLAQNNLFNNVVKGVGIGNGIISPAQALTKIGFYLEEFGKIDADGRKVVENFSDEINTLTNNGRYEEAFDLFLSIKKVVNINAGAGGLNLDDISEKLTRDKL------QEYFNRRLTA---DHYKLMEETVPPLIGLSGKVIYDGQRDAVLKAFRNSLMKPAVDKVEYLLQNTNISVTIYNGNLDAISNTPGQLLWVDNLRWSGQKDFLNYVRKPFVRSRGLQGYYRKTSQLHFYWMNSVGQSVPLDGYYGMTRILQIITNT 430          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|930654465|gb|KPI96799.1| (Retinoid-inducible serine carboxypeptidase [Papilio xuthus])

HSP 1 Score: 364.385 bits (934), Expect = 4.301e-119
Identity = 193/415 (46.51%), Postives = 276/415 (66.51%), Query Frame = 0
Query:   23 EIDNTWLEGIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGIS-EPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRI-VDSDG 435
            ++  T   G  +TA F  I  VG +FW F+PSLA ++++RPLI+WLDGVTG PPSL ANF MFGPF  +L +R DSW+  +NLL +DAP+GTG+S    +  I  N + + ++L+  L+SFY  H+E+ + P+Y+ GQG+GA+LA++L   L +       +KG+ IGNGIISPA+ALTK+GFYLEE G ID +GR  +E +SN+   L + G+  EA++ FLS+ + +N +AGA  +NL  I EK+T D   +D F ++         + +    M E V P LG+S +  +D  RE V++AF+  FM+P+   VE +L+NTN++VTIYNGNLDA+SNTPGQL WVDNL WSGQ +FL   R+  + +  ++GYFR T +L+FYWMN+ G SV L     +R I+  + V +DG
Sbjct:   29 KLQGTGFNGYKHTAAFTRISGVGDLFWLFWPSLADDSTTRPLIVWLDGVTGVPPSLRANFEMFGPFGTDL-RRQDSWIKYFNLLLIDAPVGTGYSKAEDENNISTNFEDHVDNLVSVLKSFYETHKEYTNAPVYVFGQGHGAKLAVALAARLAEKNQLNNVVKGVGIGNGIISPALALTKIGFYLEEFGKIDADGRRVVENYSNKINRLTNNGRYGEAFDLFLSIKKVINVDAGAAGLNLDDISEKLTRDK-LQDYFNRR--------LSAEQYRLMEETVPPLLGLSGKVVYDGQREAVLKAFRSSFMKPSVEKVEFLLQNTNISVTIYNGNLDAISNTPGQLLWVDNLRWSGQNDFLNDVRKPFVRSRGLQGYFRRTSRLQFYWMNSVGQSVILS----LRFIISSLYVPTDG 429          
BLAST of HiSeq13318 vs. genbank:protein
Match: gi|768446752|ref|XP_011565331.1| (PREDICTED: retinoid-inducible serine carboxypeptidase-like [Plutella xylostella])

HSP 1 Score: 343.969 bits (881), Expect = 4.260e-111
Identity = 195/431 (45.24%), Postives = 271/431 (62.88%), Query Frame = 0
Query:    4 GIGVLIWWLV-ADHSDNGNGEIDNTWLEGIPNTAEFAEIPDVGKMFWWFFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWVDDYNLLFVDAPLGTGFSTIASD-VEIPGNLDTNTEHLLQALESFYARHEEFVDTPLYIVGQGYGAQLAMSLVLGL--DKAENSTANLKGIVIGNGIISPAVALTKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEFVNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMTERVAPALGISEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTIYNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRETDKLKFYWMNAAGVSVPLDSNVGMRRIVQRI 430
            G  VLIWWLV    +  G G+I           A    I D G+MF+W++P+  + +  RPLI+WL GVT +P SL AN G FGP+D  L +RNDSWV+DYNLLF+DAPLGTGFST+ +    +P +  TN EHL   L++F+  HEE  +TP+Y++GQG+G QLA +L L L  D   +   NLKGI +GN +I P + L+K+G YL++L YI  +G    +  +     ++  GQ  E ++ +  L  +VN+  G   VNL ++++K T +S      G +  L      + +  TFM+  VA ALG+    +D  R+ V+  FK  ++  A  +VEEIL+NT LTVTIYNGNLDA+S+TPGQLEWV+ L+W GQ EFL   R  + VN ++E   RETD+LKF+W+NAAG SVP+DS + MRRI+Q I
Sbjct:   19 GGAVLIWWLVRVSETSKGYGDIKQH--------AALVPILDAGEMFYWYYPTTET-SYPRPLIVWLHGVTDEPASLAANIGAFGPYDRQLNRRNDSWVEDYNLLFIDAPLGTGFSTLVNRGPHVPTSSQTNAEHLALTLKAFFEDHEELSETPVYVIGQGHGGQLAAALALRLQQDDTLHIAKNLKGIGLGNPVIDPRLTLSKMGSYLKQLAYIR-HGITVTDSVNTILDGILVTGQPEEVFDNYARLSMYVNDIDGGTDVNLRNVIDKATRESPATST-GSRGVLATP---DAELVTFMSGEVAAALGLPG-GYDEGRQAVVDNFKVSYLNSAVPLVEEILQNTTLTVTIYNGNLDAISSTPGQLEWVNALKWDGQEEFLNRRRFQVYVNDILEASVRETDRLKFFWVNAAGQSVPVDSPIAMRRILQSI 434          
The following BLAST results are available for this feature:
BLAST of HiSeq13318 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|512907882|ref|XP_004926553.1|0.000e+060.97PREDICTED: retinoid-inducible serine carboxypeptid... [more]
gi|1073542923|gb|JAT88573.1|6.119e-17858.49hypothetical protein g.11280 [Pectinophora gossypi... [more]
gi|1073543497|gb|JAT88860.1|5.806e-16958.19hypothetical protein g.11279 [Pectinophora gossypi... [more]
gi|913313168|ref|XP_013187348.1|4.544e-15953.64PREDICTED: serine carboxypeptidase-like 51 [Amyelo... [more]
gi|357611248|gb|EHJ67387.1|3.145e-14251.63hypothetical protein KGM_01563 [Danaus plexippus][more]
gi|943976561|ref|XP_014369392.1|3.341e-12948.02PREDICTED: retinoid-inducible serine carboxypeptid... [more]
gi|910313680|ref|XP_013176782.1|1.782e-12447.57PREDICTED: retinoid-inducible serine carboxypeptid... [more]
gi|909574423|ref|XP_013142909.1|9.141e-12148.88PREDICTED: retinoid-inducible serine carboxypeptid... [more]
gi|930654465|gb|KPI96799.1|4.301e-11946.51Retinoid-inducible serine carboxypeptidase [Papili... [more]
gi|768446752|ref|XP_011565331.1|4.260e-11145.24PREDICTED: retinoid-inducible serine carboxypeptid... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0008233 peptidase activity
molecular_function GO:0004185 serine-type carboxypeptidase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001563Peptidase S10, serine carboxypeptidasePRINTSPR00724CRBOXYPTASECcoord: 403..416
score: 32.69
coord: 143..168
score: 22.26
coord: 95..107
score: 27.51
coord: 108..118
score: 53.5
IPR001563Peptidase S10, serine carboxypeptidasePFAMPF00450Peptidase_S10coord: 46..431
e-value: 1.8E-51
score: 175.4
IPR001563Peptidase S10, serine carboxypeptidasePANTHERPTHR11802SERINE PROTEASE FAMILY S10 SERINE CARBOXYPEPTIDASEcoord: 46..461
IPR029058Alpha/Beta hydrolase foldGENE3D3.40.50.1820coord: 45..433
e-value: 1.2E-74
score: 251.4
IPR029058Alpha/Beta hydrolase foldSUPERFAMILY53474alpha/beta-Hydrolasescoord: 45..432
NoneNo IPR availablePANTHERPTHR11802:SF30SERINE CARBOXYPEPTIDASE CPVL-RELATEDcoord: 46..461

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13318HiSeq13318Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13318_p ID=HiSeq13318_p|Name=HiSeq13318|organism=Ostrinia scapulalis|type=polypeptide|length=462bp
VAAGIGVLIWWLVADHSDNGNGEIDNTWLEGIPNTAEFAEIPDVGKMFWW
FFPSLASEASSRPLILWLDGVTGDPPSLLANFGMFGPFDFNLEKRNDSWV
DDYNLLFVDAPLGTGFSTIASDVEIPGNLDTNTEHLLQALESFYARHEEF
VDTPLYIVGQGYGAQLAMSLVLGLDKAENSTANLKGIVIGNGIISPAVAL
TKLGFYLEELGYIDGNGRAAIEKFSNETTYLVSEGQLAEAYEKFLSLGEF
VNEEAGAVAVNLGHIVEKVTYDSATKDIFGQKKYLRDVTGFNVDFNTFMT
ERVAPALGISEPDFDSHREEVIQAFKDVFMRPAKNMVEEILENTNLTVTI
YNGNLDAVSNTPGQLEWVDNLEWSGQGEFLISSRQTLIVNGLIEGYFRET
DKLKFYWMNAAGVSVPLDSNVGMRRIVQRIVDSDGGNNGNGEDEDDNNGN
GEDENDGNGEID
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008233peptidase activity
GO:0004185serine-type carboxypeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR001563Peptidase_S10