HiSeq13331_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13331
Unique NameHiSeq13331_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length400
Homology
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|913296355|ref|XP_013184211.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Amyelois transitella])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 274/394 (69.54%), Postives = 341/394 (86.55%), Query Frame = 0
Query:    7 LASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVET 400
            LA DV  YL++  EY  +KD+LP  LLRKYK+PE+MYLINK TA  I T + ++I+    V+EVNPG  F+S+ELL+Q+ NHIYMYE S+HF+ HL+ L  K+PGR+TYK+ADFFGMWKLAFKDK+D GNR+++LLG+L++++S R VKI+GSMPGL F+KH++NNIIF+ T NQLGRPDLFITMPG HY++LTDN+IQF+KHKS+PALFQ+ FDYK+LT VPKVHFLPWT+  S K+ +++DE  +YLVNITQK++LPCP EYLPLLWYFFKPHM +K+TR+IPMLEQWIPGCGVWLI+GQDPPD NK+IAP +DDA+LPHMTIFTEFGDL L+QKITVFKKFVSWPEFEQCPF++TME+NLPK V+ LD +DKDNI +HIDDIE+ D +VE+
Sbjct:   39 LAQDVLKYLDSFPEYMLLKDQLPKSLLRKYKSPENMYLINKDTAGEIVTVMKEYIDKDCPVVEVNPGFCFMSQELLNQVPNHIYMYEMSHHFAPHLNLLKNKYPGRITYKMADFFGMWKLAFKDKLDQGNRMKDLLGNLASDNSDRIVKIVGSMPGLAFVKHMVNNIIFNYTTNQLGRPDLFITMPGYHYEYLTDNEIQFNKHKSLPALFQMLFDYKILTNVPKVHFLPWTYKQSGKRVTMMDEYRMYLVNITQKEKLPCPPEYLPLLWYFFKPHMLTKNTRIIPMLEQWIPGCGVWLISGQDPPDINKEIAPNEDDAKLPHMTIFTEFGDLTLRQKITVFKKFVSWPEFEQCPFRMTMESNLPKLVVPLDDDDKDNIVSHIDDIENCDTDVES 432          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|943941091|ref|XP_014371976.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Papilio machaon])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 269/399 (67.42%), Postives = 332/399 (83.21%), Query Frame = 0
Query:    1 MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVE 399
            + K  KLA+DV  YLEN ++Y  + +KLP FLLRKYKTPESMYLIN +TAK IA TV  +IN+ S V+EVNPGLGFLS+ELL    NH+Y+YETS+HF+ HL +L  +   R+TYKVADFFGMWKLAF+DK+D GNRI ELLG L+++D SR +KI+G+MPGL F+KHL+ NI+FH   +QLGR DLFITMP +HY++LTDN +Q  K K++PALFQ FFD KVL  VPKVH+LPWT+PPS KK++++DE  LYLVNITQK++LPCPS+YLPLLWYFFKPH+ +K+T+VIPMLEQWIPGCGVWLITGQDPPDTNK + P  +DA LPHMTIFTEFGDLNLKQKITVFK+F+SWPEFEQCPF+VTME+NLPK +  ++ +DK  + TH+DDI+ SD E +
Sbjct:   29 VEKQPKLAADVLKYLENDSDYSKIIEKLPRFLLRKYKTPESMYLINTKTAKEIAATVGSYINEESPVVEVNPGLGFLSKELLKCTKNHLYLYETSSHFTQHLEALQHEKSKRLTYKVADFFGMWKLAFQDKMDGGNRIPELLGDLASHDKSRIIKIVGAMPGLNFVKHLIYNIVFHNDTDQLGRTDLFITMPAHHYRYLTDNDVQERKFKTIPALFQTFFDCKVLIKVPKVHYLPWTYPPSGKKAALMDEYCLYLVNITQKEKLPCPSDYLPLLWYFFKPHICTKTTKVIPMLEQWIPGCGVWLITGQDPPDTNKVLGPNNEDAPLPHMTIFTEFGDLNLKQKITVFKRFISWPEFEQCPFRVTMESNLPKSISQIEDDDKRRLSTHLDDIDVSDGETD 427          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|910334967|ref|XP_013170932.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Papilio xuthus])

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 268/399 (67.17%), Postives = 329/399 (82.46%), Query Frame = 0
Query:    1 MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVE 399
            + K  KLA+DV  YLEN ++Y  + +KLP  LLRKYKTPESMYLIN  TAK IA TV  HIN+ S ++EVNPGLGFLS+ELL    NH+Y+YETS+HF+ HL +L  +   R+TYKVADFFGMWKLAF+DK+D GNR+ ELLG L+++D SR + I+G+MPGL F+KHL+ NI+FH   +QLGR DLFITMP +HY++LTDN IQ  K K++PALFQ FFD KVL  VPKVHFLPWT+PPS KK++++DE  LYLVNITQK++LPCP++YLPLLWYFFKPH+ SK+T+VIPMLEQWIPGCGVWLITGQDPPD+NK + P  +DA LPHMTIFTEFGDLNLKQKITVFK+F+SWPEFEQCPF+VTME+NLPK +  ++ +DK  + THIDDI+ SD E +
Sbjct:   29 VEKQPKLAADVLKYLENDSDYSKIIEKLPRPLLRKYKTPESMYLINTTTAKEIAETVRNHINEESPIVEVNPGLGFLSKELLQCTKNHLYLYETSSHFTQHLEALQREKNKRLTYKVADFFGMWKLAFQDKMDGGNRLSELLGDLASHDKSRIINIVGAMPGLNFVKHLIFNIVFHNDTDQLGRTDLFITMPAHHYRYLTDNDIQERKFKTIPALFQTFFDCKVLIKVPKVHFLPWTYPPSGKKAALMDEYCLYLVNITQKEKLPCPADYLPLLWYFFKPHICSKTTKVIPMLEQWIPGCGVWLITGQDPPDSNKSLGPNNEDAPLPHMTIFTEFGDLNLKQKITVFKRFISWPEFEQCPFRVTMESNLPKSISQIEDDDKRRMSTHIDDIDVSDGETD 427          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|930649934|gb|KPI92280.1| (Dimethyladenosine transferase 2, mitochondrial [Papilio xuthus])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 267/399 (66.92%), Postives = 328/399 (82.21%), Query Frame = 0
Query:    1 MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVE 399
            + K  KLA+DV  YLEN ++Y  + +KLP  LLRKYKTPESMYLIN  TAK IA TV  HIN+ S ++EVNPGLGFLS+ELL    NH+Y+YETS+HF+ HL +L  +   R+TYKVADFFGMWKLAF+DK+D GNR+ ELLG L+++D SR + I+G+MPGL F+KHL+ NI+FH   +QLGR DLFITMP +HY++LTDN IQ  K K++PALFQ FFD KVL  VPKVHFLPWT+PPS KK++++DE  LYLVNITQK++LPCP++YLPLLWYFFKPH+ SK+T+VIPMLEQWIPGCGVWLIT QDPPD+NK + P  +DA LPHMTIFTEFGDLNLKQKITVFK+F+SWPEFEQCPF+VTME+NLPK +  ++ +DK  + THIDDI+ SD E +
Sbjct:   89 VEKQPKLAADVLKYLENDSDYSKIIEKLPRPLLRKYKTPESMYLINTTTAKEIAETVRSHINEESPIVEVNPGLGFLSKELLQCTKNHLYLYETSSHFTQHLEALQHEKNKRLTYKVADFFGMWKLAFQDKMDGGNRLSELLGDLASHDKSRIINIVGAMPGLNFVKHLIFNIVFHNDTDQLGRTDLFITMPAHHYRYLTDNDIQERKFKTIPALFQTFFDCKVLIKVPKVHFLPWTYPPSGKKAALMDEYCLYLVNITQKEKLPCPADYLPLLWYFFKPHICSKTTKVIPMLEQWIPGCGVWLITRQDPPDSNKSLGPNNEDAPLPHMTIFTEFGDLNLKQKITVFKRFISWPEFEQCPFRVTMESNLPKSISQIEDDDKRRLSTHIDDIDVSDGETD 487          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|1073538851|gb|JAT86537.1| (hypothetical protein g.6935, partial [Pectinophora gossypiella])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 276/397 (69.52%), Postives = 328/397 (82.62%), Query Frame = 0
Query:    5 LKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGED-KDNIGTHIDDIEHSDAEVET 400
            +K A+DV  YLE+  EY  +KDKLP  LLRKYK PESMYLIN+QTAK IA  V  H++D S V+EVNPGLGFLSEELL +  +H Y+YETS+HF+  L  L  ++P RV+YK+ADFF MWKLAF+DK+D GNRI+ELLG LST D+ R VKIIGSMP L+F+KHL+N I+FH +++QLGRPDLFITMPG+ + FLTD+ IQ SK+KSVPALFQ+ FDYK++ TVP VHFLPWT PP+ K  S+ D  +L+LVNITQK +LPCP +YLPLLWYFFKPH+FS+STRVIPMLEQWIPGCGVWLITGQDPPDT   +APG DDA LPHMTIFTEFGDLNLKQKITVFKKF+SWPEFEQC F+VTMENNLPK V  LD +D KD I  HI+ ++HSD+E E+
Sbjct:   23 IKAAADVVKYLESIPEYEEIKDKLPKSLLRKYKAPESMYLINRQTAKEIANAVQNHLDD-SPVVEVNPGLGFLSEELLKRHKSHHYIYETSSHFTPFLEKLKNEYPDRVSYKIADFFEMWKLAFQDKMDEGNRIKELLGDLSTEDNDRIVKIIGSMPRLSFMKHLINTIVFHNSDSQLGRPDLFITMPGHQFDFLTDSDIQLSKYKSVPALFQVLFDYKIIRTVPIVHFLPWTHPPTGKNVSLTDNYHLFLVNITQKAKLPCPPDYLPLLWYFFKPHVFSRSTRVIPMLEQWIPGCGVWLITGQDPPDTRPDLAPGPDDAALPHMTIFTEFGDLNLKQKITVFKKFISWPEFEQCQFRVTMENNLPKSVSHLDDDDGKDVIPAHIEHLDHSDSESES 418          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|1073527101|gb|JAT80662.1| (hypothetical protein g.6934 [Pectinophora gossypiella])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 276/397 (69.52%), Postives = 328/397 (82.62%), Query Frame = 0
Query:    5 LKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGED-KDNIGTHIDDIEHSDAEVET 400
            +K A+DV  YLE+  EY  +KDKLP  LLRKYK PESMYLIN+QTAK IA  V  H++D S V+EVNPGLGFLSEELL +  +H Y+YETS+HF+  L  L  ++P RV+YK+ADFF MWKLAF+DK+D GNRI+ELLG LST D+ R VKIIGSMP L+F+KHL+N I+FH +++QLGRPDLFITMPG+ + FLTD+ IQ SK+KSVPALFQ+ FDYK++ TVP VHFLPWT PP+ K  S+ D  +L+LVNITQK +LPCP +YLPLLWYFFKPH+FS+STRVIPMLEQWIPGCGVWLITGQDPPDT   +APG DDA LPHMTIFTEFGDLNLKQKITVFKKF+SWPEFEQC F+VTMENNLPK V  LD +D KD I  HI+ ++HSD+E E+
Sbjct:   37 IKAAADVVKYLESIPEYEEIKDKLPKSLLRKYKAPESMYLINRQTAKEIANAVQNHLDD-SPVVEVNPGLGFLSEELLKRHKSHHYIYETSSHFTPFLEKLKNEYPDRVSYKIADFFEMWKLAFQDKMDEGNRIKELLGDLSTEDNDRIVKIIGSMPRLSFMKHLINTIVFHNSDSQLGRPDLFITMPGHQFDFLTDSDIQLSKYKSVPALFQVLFDYKIIRTVPIVHFLPWTHPPTGKNVSLTDNYHLFLVNITQKAKLPCPPDYLPLLWYFFKPHVFSRSTRVIPMLEQWIPGCGVWLITGQDPPDTRPDLAPGPDDAALPHMTIFTEFGDLNLKQKITVFKKFISWPEFEQCQFRVTMENNLPKSVSHLDDDDGKDVIPAHIEHLDHSDSESES 432          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|909561166|ref|XP_013135700.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Papilio polytes])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 264/399 (66.17%), Postives = 326/399 (81.70%), Query Frame = 0
Query:    1 MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVE 399
            + K  KLA+DV  YLEN  +Y  + +KLP  LLRKYKTPESMYLIN +TA+ IA T+  H+N+ S V+EVNPGLG+LS+ELL    NHIY+YETS+HFS HL +L  +   R+TYKVADFFGMWKLAF+DK+D GNR+ ELLG L++ND +R +KI+G+MPGL F+KHL+ NI+F+   + LGR DLFITMP +HY++LTD  IQ  K K++PALFQ FFD KVL  VPKVH+LPWT+PPS KK+ ++DE +L LVNITQK++LPCP++YLPLLWYF KPH+ SK+T+VIPMLEQWIPGCGVWLITGQDPPD+NK + P  +DA LPHMTIFTEFGDLNLKQKITVFK+F+SWPEFEQCPF+VTME+NLPK +  ++ +DK  + THIDDIE SD E E
Sbjct:   29 LEKQPKLATDVLKYLENDTDYSKIIEKLPRSLLRKYKTPESMYLINTKTAREIAETIRNHVNEESPVVEVNPGLGYLSKELLQCTKNHIYLYETSSHFSPHLEALRNEKSKRLTYKVADFFGMWKLAFQDKMDGGNRLTELLGDLASNDKNRIIKIVGAMPGLNFVKHLIYNIVFNNDTDLLGRTDLFITMPAHHYRYLTDIDIQEGKFKTIPALFQSFFDCKVLINVPKVHYLPWTYPPSGKKALMMDEYSLCLVNITQKEKLPCPADYLPLLWYFLKPHICSKTTKVIPMLEQWIPGCGVWLITGQDPPDSNKLLCPTSEDAPLPHMTIFTEFGDLNLKQKITVFKRFISWPEFEQCPFRVTMESNLPKSISQIEDDDKRRLNTHIDDIEESDGETE 427          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|827542722|ref|XP_012544415.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Bombyx mori])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 266/400 (66.50%), Postives = 315/400 (78.75%), Query Frame = 0
Query:    3 KDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIG--THIDDIEHSDAEVET 400
            K  KLA DV  +L +S EY  +K++LP  LLRKYK PES                       S +IEVNPGLG L+E +L   NN IY++E SNHFS +L  L  K+PGR+++K+ADFFGMWKLAFKDK+D+GNRIQELLG LST D +RTVKI+GSMPGL+F+KHL+ N++FH T NQLGRPDLFITMP +HY+FLTD ++Q SK KSVP LFQL FD K LTTV K HFLPWT   +SK  SVL+E NLYLVNITQK++LPCP+EYLPLLWYFFKP MFSKSTRVIPMLEQWIPGCGVWLITGQDPPD+NK ++PGKDDA LPHMTIFTE GDLNL+QKITVFK+F+SWPEFEQC F++TMENNLPK V   + +DKD+I   THID ++HSD EV++
Sbjct:   11 KQPKLAEDVLKFLNSSPEYNGLKEQLPTSLLRKYKAPES-----------------------SPLIEVNPGLGILTENILKCQNNKIYLFEQSNHFSPYLDDLQQKYPGRISFKIADFFGMWKLAFKDKMDDGNRIQELLGDLSTTDKNRTVKILGSMPGLSFMKHLIYNVLFHNTTNQLGRPDLFITMPVHHYEFLTDKEVQQSKQKSVPTLFQLLFDCKTLTTVTKAHFLPWTL-SNSKHHSVLNEHNLYLVNITQKEKLPCPAEYLPLLWYFFKPQMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDSNKLLSPGKDDASLPHMTIFTELGDLNLQQKITVFKRFISWPEFEQCQFRITMENNLPKSVTQFEDDDKDSIPTITHIDHMDHSDTEVDS 386          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|768419621|ref|XP_011550535.1| (PREDICTED: dimethyladenosine transferase 2, mitochondrial [Plutella xylostella])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 253/398 (63.57%), Postives = 319/398 (80.15%), Query Frame = 0
Query:    4 DLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNI-GTHI-DDIEHSDAEVE 399
            DLKLA DV  YLE    Y N+K+ +P  LLRKYKTPESMYLI+KQTA  IA T+ +H+N  S V+EVNPG GFL+EELL      +++YE SN+FS  +  L  K+P + ++KVADFFGMWKLAF+DKIDNGNRI+ELLG L+T+D+ R +KI+G+MPG++F++HL+N IIFH ++NQLGRPDL++ MPG+++ FLTD  +Q  KHKS+PA+FQL FD KV+T +PK ++LPW  PP  KK+SV+DE  LYLVNI QK++LPC S++LPLLWYFF+PHM SKSTR+IPMLEQWIPGCGVWLITGQDP ++    APG  DA LPH+ IFTEFGDL L QK+TVFKKF+SWPEF+QCPF+VTMENNLPKF+  +D ++K+ I GT I DD+E SD E E
Sbjct:   35 DLKLAPDVMKYLETLPYYDNIKESIPKTLLRKYKTPESMYLIHKQTATVIAETLKEHLNTGSPVVEVNPGFGFLTEELLKHRIEPLHLYEVSNNFSPFIMELQKKYPDKFSHKVADFFGMWKLAFQDKIDNGNRIKELLGDLTTDDNDRILKIVGAMPGISFVRHLINTIIFHHSHNQLGRPDLYMAMPGDYFNFLTDQGMQNVKHKSLPAMFQLLFDTKVITKIPKTYYLPWMHPPDKKKASVIDEYCLYLVNIKQKQQLPCSSDHLPLLWYFFRPHMISKSTRIIPMLEQWIPGCGVWLITGQDPAESRAARAPGPHDAPLPHINIFTEFGDLTLPQKLTVFKKFISWPEFDQCPFRVTMENNLPKFISAIDLDEKETIAGTPIDDDMEASDVEQE 432          
BLAST of HiSeq13331 vs. genbank:protein
Match: gi|930678234|gb|KPJ18212.1| (Dimethyladenosine transferase 2, mitochondrial [Papilio machaon])

HSP 1 Score: 494.197 bits (1271), Expect = 5.837e-172
Identity = 237/399 (59.40%), Postives = 291/399 (72.93%), Query Frame = 0
Query:    1 MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTAKHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSSHLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDSSRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLTDNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDECNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGCGVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKFVSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVE 399
            + K  KLA+DV  YLEN ++Y  + +KLP FLLRKYKTPESMYLIN +TAK IA TV  +IN+ S V+EVNPGLGFLS+ELL    NH+Y+YETS+HF+ HL +L  +   R+TYKVADFFGMWKLAF+DK+D GNRI ELLG L+++D SR +KI+G+MPGL F+KHL+ NI+FH   +QLGR DLFITMP +HY+                                                  +DE  LYLVNITQK++LPCPS+YLPLLWYFFKPH+ +K+T+VIPMLEQWIPGCGVWLITGQDPPDTNK + P  +DA LPHMTIFTEFGDLNLKQKITVFK+F+SWPEFEQCPF+VTME+NLPK +  ++ +DK  + TH+DDI+ SD E +
Sbjct:   29 VEKQPKLAADVLKYLENDSDYSKIIEKLPRFLLRKYKTPESMYLINTKTAKEIAATVGSYINEESPVVEVNPGLGFLSKELLKCTKNHLYLYETSSHFTQHLEALQHEKSKRLTYKVADFFGMWKLAFQDKMDGGNRIPELLGDLASHDKSRIIKIVGAMPGLNFVKHLIYNIVFHNDTDQLGRTDLFITMPAHHYR--------------------------------------------------MDEYCLYLVNITQKEKLPCPSDYLPLLWYFFKPHICTKTTKVIPMLEQWIPGCGVWLITGQDPPDTNKVLGPNNEDAPLPHMTIFTEFGDLNLKQKITVFKRFISWPEFEQCPFRVTMESNLPKSISQIEDDDKRRLSTHLDDIDVSDGETD 377          
The following BLAST results are available for this feature:
BLAST of HiSeq13331 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913296355|ref|XP_013184211.1|0.000e+069.54PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|943941091|ref|XP_014371976.1|0.000e+067.42PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|910334967|ref|XP_013170932.1|0.000e+067.17PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|930649934|gb|KPI92280.1|0.000e+066.92Dimethyladenosine transferase 2, mitochondrial [Pa... [more]
gi|1073538851|gb|JAT86537.1|0.000e+069.52hypothetical protein g.6935, partial [Pectinophora... [more]
gi|1073527101|gb|JAT80662.1|0.000e+069.52hypothetical protein g.6934 [Pectinophora gossypie... [more]
gi|909561166|ref|XP_013135700.1|0.000e+066.17PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|827542722|ref|XP_012544415.1|0.000e+066.50PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|768419621|ref|XP_011550535.1|0.000e+063.57PREDICTED: dimethyladenosine transferase 2, mitoch... [more]
gi|930678234|gb|KPJ18212.1|5.837e-17259.40Dimethyladenosine transferase 2, mitochondrial [Pa... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0032259 methylation
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0031167 rRNA methylation
biological_process GO:0006364 rRNA processing
biological_process GO:0006351 transcription, DNA-templated
biological_process GO:0006391 transcription initiation from mitochondrial promoter
cellular_component GO:0005739 mitochondrion
molecular_function GO:0008168 methyltransferase activity
molecular_function GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
molecular_function GO:0003712 transcription cofactor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseGENE3D3.40.50.150coord: 23..235
e-value: 8.8E-12
score: 44.1
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILY53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 32..312
IPR016861Mitochondrial transcription factor TFB2PIRSFPIRSF027833MtTFB2coord: 7..399
e-value: 8.5E-60
score: 200.3
IPR001737Ribosomal RNA adenine methyltransferase KsgA/ErmPFAMPF00398RrnaADcoord: 41..295
e-value: 3.9E-12
score: 45.6
IPR001737Ribosomal RNA adenine methyltransferase KsgA/ErmPANTHERPTHR11727DIMETHYLADENOSINE TRANSFERASEcoord: 43..302
NoneNo IPR availablePANTHERPTHR11727:SF13DIMETHYLADENOSINE TRANSFERASE 2, MITOCHONDRIALcoord: 43..302

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13331HiSeq13331Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13331_p ID=HiSeq13331_p|Name=HiSeq13331|organism=Ostrinia scapulalis|type=polypeptide|length=400bp
MXKDLKLASDVTNYLENSAEYCNVKDKLPNFLLRKYKTPESMYLINKQTA
KHIATTVSKHINDASTVIEVNPGLGFLSEELLHQLNNHIYMYETSNHFSS
HLSSLLGKHPGRVTYKVADFFGMWKLAFKDKIDNGNRIQELLGSLSTNDS
SRTVKIIGSMPGLTFIKHLLNNIIFHTTNNQLGRPDLFITMPGNHYQFLT
DNQIQFSKHKSVPALFQLFFDYKVLTTVPKVHFLPWTFPPSSKKSSVLDE
CNLYLVNITQKKELPCPSEYLPLLWYFFKPHMFSKSTRVIPMLEQWIPGC
GVWLITGQDPPDTNKKIAPGKDDAELPHMTIFTEFGDLNLKQKITVFKKF
VSWPEFEQCPFKVTMENNLPKFVLDLDGEDKDNIGTHIDDIEHSDAEVET
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0032259methylation
GO:0006364rRNA processing
GO:0031167rRNA methylation
GO:0006355regulation of transcription, DNA-templated
GO:0006391transcription initiation from mitochondrial promoter
Vocabulary: Molecular Function
TermDefinition
GO:0008168methyltransferase activity
GO:0003712transcription cofactor activity
GO:0000179rRNA (adenine-N6,N6-)-dimethyltransferase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005739mitochondrion
Vocabulary: INTERPRO
TermDefinition
IPR001737KsgA/Erm
IPR016861TFB2M
IPR029063SAM-dependent_MTases