HiSeq13350_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13350
Unique NameHiSeq13350_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length214
Homology
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|943967544|ref|XP_014365730.1| (PREDICTED: serpin B4-like [Papilio machaon])

HSP 1 Score: 100.523 bits (249), Expect = 3.228e-22
Identity = 68/212 (32.08%), Postives = 110/212 (51.89%), Query Frame = 0
Query:    5 INSKIFVSSSSEETTKHGEFDSQRIDFRDSAE-RNAINDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTSGN-FKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIFDIGTFNVE 214
            I +K+F  +S  ++TK  + + ++  F  S E   A+ +WVN++ +     +  IFP+   + L N+  +K +W       S  +KVYNSF+YT+D+KYE R+L L T  +     ++VPNE DVL  L   L  EGL AA   +QP F  T K   P+    S I+           AT   +G VK+++N +++ V    +   G+F ++
Sbjct:   45 IKNKLFQLAS--DSTK-SQLNLEKKTFTSSQEIYAAVKNWVNQYGDFQFEPEKYIFPEANGL-LSNVCMYKGSW------KSAMVKVYNSFSYTEDIKYEVRMLVLSTCDDDVSFAIVVPNETDVLCHLVQKLHEEGLSAALTTIQPTFTATCKQNLPTFQFNSNIVLLDP---QNAKATILQYGCVKVDQNGIDVKVLTCLLVGKGSFKID 243          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|1073524993|gb|JAT79608.1| (hypothetical protein g.8741 [Pectinophora gossypiella] >gi|1073532967|gb|JAT83595.1| hypothetical protein g.8743 [Pectinophora gossypiella])

HSP 1 Score: 100.138 bits (248), Expect = 8.477e-22
Identity = 48/141 (34.04%), Postives = 81/141 (57.45%), Query Frame = 0
Query:   27 QRIDFRDSAERNAINDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTS-GNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICS 166
            +++DF      + I++W N+  +   ++     P D    ++++  F+  W      G   MK++NSFNYTQD+ YE R++ELPT   +F++++L P++ D+LH LF  L NEGL A+   +QP+F+  +    P I I S
Sbjct:   91 KQVDFSKEQAGDIISEWANQQDDFKTFNIEKSIPADILYAVVDMSNFQGAWEKKSSKGR-FMKIHNSFNYTQDINYEARIMELPTQDSDFRVIVLAPSQTDLLHTLFRRLTNEGLAASFASVQPLFSVDSVFTPPDIAITS 230          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|1073543011|gb|JAT88617.1| (hypothetical protein g.8745, partial [Pectinophora gossypiella])

HSP 1 Score: 100.138 bits (248), Expect = 2.016e-21
Identity = 48/141 (34.04%), Postives = 81/141 (57.45%), Query Frame = 0
Query:   27 QRIDFRDSAERNAINDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTS-GNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICS 166
            +++DF      + I++W N+  +   ++     P D    ++++  F+  W      G   MK++NSFNYTQD+ YE R++ELPT   +F++++L P++ D+LH LF  L NEGL A+   +QP+F+  +    P I I S
Sbjct:  135 KQVDFSKEQAGDIISEWANQQDDFKTFNIEKSIPADILYAVVDMSNFQGAWEKKSSKGR-FMKIHNSFNYTQDINYEARIMELPTQDSDFRVIVLAPSQTDLLHTLFRRLTNEGLAASFASVQPLFSVDSVFTPPDIAITS 274          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|909563670|ref|XP_013137069.1| (PREDICTED: uncharacterized protein LOC106102201 isoform X2 [Papilio polytes])

HSP 1 Score: 89.7373 bits (221), Expect = 2.786e-18
Identity = 59/176 (33.52%), Postives = 90/176 (51.14%), Query Frame = 0
Query:   33 DSAERNAINDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTS-GNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKI-IREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIF 206
            D   +  +  W NE+A+    +K    P D +  L NI  +K  W       SP +KV+NSF+YT+D+KYE R+LE+ +   +    ++VPNE DVL  L   L  EGL AA   +QP F  T +   P+    S I IR+Q+     +T +    G V +N++ ++I V    + 
Sbjct:   55 DVELKAVVEKWANEYAKFEFQTKKYNIPDDKAF-LTNICMYKGAW------KSPMVKVHNSFSYTEDIKYEVRILEVCSCDDDVSFAIVVPNETDVLCHLVQKLHEEGLSAAVATIQPAFTATCRQNLPTFKFKSNIDIRDQQ--DTKITQS----GCVTVNQSGIDIKVLTCLLL 217          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|909563668|ref|XP_013137068.1| (PREDICTED: uncharacterized protein LOC106102201 isoform X1 [Papilio polytes])

HSP 1 Score: 89.7373 bits (221), Expect = 5.294e-18
Identity = 59/176 (33.52%), Postives = 90/176 (51.14%), Query Frame = 0
Query:   33 DSAERNAINDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTS-GNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKI-IREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIF 206
            D   +  +  W NE+A+    +K    P D +  L NI  +K  W       SP +KV+NSF+YT+D+KYE R+LE+ +   +    ++VPNE DVL  L   L  EGL AA   +QP F  T +   P+    S I IR+Q+     +T +    G V +N++ ++I V    + 
Sbjct:   82 DVELKAVVEKWANEYAKFEFQTKKYNIPDDKAF-LTNICMYKGAW------KSPMVKVHNSFSYTEDIKYEVRILEVCSCDDDVSFAIVVPNETDVLCHLVQKLHEEGLSAAVATIQPAFTATCRQNLPTFKFKSNIDIRDQQ--DTKITQS----GCVTVNQSGIDIKVLTCLLL 244          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|910320696|ref|XP_013163245.1| (PREDICTED: uncharacterized protein LOC106114537 isoform X4 [Papilio xuthus])

HSP 1 Score: 88.9669 bits (219), Expect = 6.201e-18
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 0
Query:   23 EFDSQRIDFRDSAERNA-INDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTSGNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIFDIGT 210
            +F+ ++  F  S E +A + +W+N++ +     +   +P+  ++ L N+  +K  W       S  +KV+NSF+YT+D+KYE R+L +    +    ++VPNE DVL  L   L  EGL AA   +QP F  T K   P+    S I+     V      T   +G V +++  ++I V +  +   G+
Sbjct:   45 QFNLEKEIFTSSQESSAAVKNWINQYGDFQFEPEKYNYPEAKAL-LTNVCMYKGAW------KSSMVKVHNSFSYTEDIKYEVRMLVVSICDDVSFAIVVPNETDVLCHLVQKLHEEGLSAALTTIQPAFTATCKQNLPTFQFNSSIVLR---VPPDAKTTISQYGCVTVDQTGIDIKVLSCLLVGKGS 223          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|910320698|ref|XP_013163246.1| (PREDICTED: uncharacterized protein LOC106114537 isoform X5 [Papilio xuthus])

HSP 1 Score: 88.5817 bits (218), Expect = 7.495e-18
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 0
Query:   23 EFDSQRIDFRDSAERNA-INDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTSGNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIFDIGT 210
            +F+ ++  F  S E +A + +W+N++ +     +   +P+  ++ L N+  +K  W       S  +KV+NSF+YT+D+KYE R+L +    +    ++VPNE DVL  L   L  EGL AA   +QP F  T K   P+    S I+     V      T   +G V +++  ++I V +  +   G+
Sbjct:   41 QFNLEKEIFTSSQESSAAVKNWINQYGDFQFEPEKYNYPEAKAL-LTNVCMYKGAW------KSSMVKVHNSFSYTEDIKYEVRMLVVSICDDVSFAIVVPNETDVLCHLVQKLHEEGLSAALTTIQPAFTATCKQNLPTFQFNSSIVLR---VPPDAKTTISQYGCVTVDQTGIDIKVLSCLLVGKGS 219          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|910320692|ref|XP_013163243.1| (PREDICTED: uncharacterized protein LOC106114537 isoform X2 [Papilio xuthus])

HSP 1 Score: 88.9669 bits (219), Expect = 8.226e-18
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 0
Query:   23 EFDSQRIDFRDSAERNA-INDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTSGNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIFDIGT 210
            +F+ ++  F  S E +A + +W+N++ +     +   +P+  ++ L N+  +K  W       S  +KV+NSF+YT+D+KYE R+L +    +    ++VPNE DVL  L   L  EGL AA   +QP F  T K   P+    S I+     V      T   +G V +++  ++I V +  +   G+
Sbjct:   60 QFNLEKEIFTSSQESSAAVKNWINQYGDFQFEPEKYNYPEAKAL-LTNVCMYKGAW------KSSMVKVHNSFSYTEDIKYEVRMLVVSICDDVSFAIVVPNETDVLCHLVQKLHEEGLSAALTTIQPAFTATCKQNLPTFQFNSSIVLR---VPPDAKTTISQYGCVTVDQTGIDIKVLSCLLVGKGS 238          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|910320688|ref|XP_013163241.1| (PREDICTED: uncharacterized protein LOC106114537 isoform X1 [Papilio xuthus] >gi|910320690|ref|XP_013163242.1| PREDICTED: uncharacterized protein LOC106114537 isoform X1 [Papilio xuthus])

HSP 1 Score: 88.9669 bits (219), Expect = 8.679e-18
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 0
Query:   23 EFDSQRIDFRDSAERNA-INDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTSGNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIFDIGT 210
            +F+ ++  F  S E +A + +W+N++ +     +   +P+  ++ L N+  +K  W       S  +KV+NSF+YT+D+KYE R+L +    +    ++VPNE DVL  L   L  EGL AA   +QP F  T K   P+    S I+     V      T   +G V +++  ++I V +  +   G+
Sbjct:   64 QFNLEKEIFTSSQESSAAVKNWINQYGDFQFEPEKYNYPEAKAL-LTNVCMYKGAW------KSSMVKVHNSFSYTEDIKYEVRMLVVSICDDVSFAIVVPNETDVLCHLVQKLHEEGLSAALTTIQPAFTATCKQNLPTFQFNSSIVLR---VPPDAKTTISQYGCVTVDQTGIDIKVLSCLLVGKGS 242          
BLAST of HiSeq13350 vs. genbank:protein
Match: gi|909563675|ref|XP_013137072.1| (PREDICTED: serpin B4-like isoform X4 [Papilio polytes])

HSP 1 Score: 85.8853 bits (211), Expect = 8.293e-17
Identity = 59/169 (34.91%), Postives = 88/169 (52.07%), Query Frame = 0
Query:   40 INDWVNEHAEEIMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDVKYETRLLELPTS-GNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPMFATTTKLEAPSINICSKI-IREQEFVINGVTATGQYFGNVKINENEVNINVXNMFIF 206
            I D  NE+A+    +K    P D +  L NI  +K  W       SP +KV+NSF+YT+D+KYE R+LE+ +   +    ++VPNE DVL  L   L  EGL AA   +QP F  T +   P+    S I IR+Q+     +T +    G V +N++ ++I V    + 
Sbjct:   56 IFDRANEYAKFEFQTKKYNIPDDKAF-LTNICMYKGAW------KSPMVKVHNSFSYTEDIKYEVRILEVCSCDDDVSFAIVVPNETDVLCHLVQKLHEEGLSAAVATIQPAFTATCRQNLPTFKFKSNIDIRDQQ--DTKITQS----GCVTVNQSGIDIKVLTCLLL 211          
The following BLAST results are available for this feature:
BLAST of HiSeq13350 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|943967544|ref|XP_014365730.1|3.228e-2232.08PREDICTED: serpin B4-like [Papilio machaon][more]
gi|1073524993|gb|JAT79608.1|8.477e-2234.04hypothetical protein g.8741 [Pectinophora gossypie... [more]
gi|1073543011|gb|JAT88617.1|2.016e-2134.04hypothetical protein g.8745, partial [Pectinophora... [more]
gi|909563670|ref|XP_013137069.1|2.786e-1833.52PREDICTED: uncharacterized protein LOC106102201 is... [more]
gi|909563668|ref|XP_013137068.1|5.294e-1833.52PREDICTED: uncharacterized protein LOC106102201 is... [more]
gi|910320696|ref|XP_013163245.1|6.201e-1829.10PREDICTED: uncharacterized protein LOC106114537 is... [more]
gi|910320698|ref|XP_013163246.1|7.495e-1829.10PREDICTED: uncharacterized protein LOC106114537 is... [more]
gi|910320692|ref|XP_013163243.1|8.226e-1829.10PREDICTED: uncharacterized protein LOC106114537 is... [more]
gi|910320688|ref|XP_013163241.1|8.679e-1829.10PREDICTED: uncharacterized protein LOC106114537 is... [more]
gi|909563675|ref|XP_013137072.1|8.293e-1734.91PREDICTED: serpin B4-like isoform X4 [Papilio poly... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.30.497.10coord: 18..91
e-value: 5.2E-7
score: 28.5
NoneNo IPR availableGENE3D2.30.39.10coord: 92..149
e-value: 2.8E-7
score: 30.4
IPR023796Serpin domainSUPERFAMILY56574Serpinscoord: 18..150

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13350HiSeq13350Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13350_p ID=HiSeq13350_p|Name=HiSeq13350|organism=Ostrinia scapulalis|type=polypeptide|length=214bp
MXNTINSKIFVSSSSEETTKHGEFDSQRIDFRDSAERNAINDWVNEHAEE
IMYSKNTIFPKDTSMVLMNIHRFKDTWWAGHIGGSPSMKVYNSFNYTQDV
KYETRLLELPTSGNFKLVLLVPNEMDVLHDLFSTLCNEGLEAATNCLQPM
FATTTKLEAPSINICSKIIREQEFVINGVTATGQYFGNVKINENEVNINV
XNMFIFDIGTFNVE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR023796Serpin_dom