HiSeq13353_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13353
Unique NameHiSeq13353_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length480
Homology
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|910341262|ref|XP_013174337.1| (PREDICTED: zinc finger protein CG2199-like isoform X1 [Papilio xuthus])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 331/478 (69.25%), Postives = 393/478 (82.22%), Query Frame = 0
Query:    2 DEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASL 479
            +EEDFVGCISCM+  DLCDLFA YA+NEETYA+M ++C++IK++ + K+IC+ CVE LEKA+AFK QT+KN+A+ QSIKDEEYLDE+ILEE +G   D +G   S   + +D    DDI++EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG ++REC+LCG  +   ADH +RCH   SE E R+Y CHFCDN+YNSKKACFTHLRMKHGLKLCND TPK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF +MDDFMLFKSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHG CPY+EPREPK+ K E T E  P+  +CD+CG GF   DKF+ HV  H     PC +C   FQ+I+AWT H+R+EH+   L
Sbjct:    3 EEEDFVGCISCMNNKDLCDLFAIYADNEETYAQMLKSCYNIKISTEYKFICSDCVEKLEKASAFKNQTSKNLAMLQSIKDEEYLDESILEEGEGLTVDYRGNKTSHLTSTED---VDDINEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGQRVRECSLCGASLNDLADHINRCHSATSESESRQYACHFCDNVYNSKKACFTHLRMKHGLKLCNDHTPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGTMDDFMLFKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGTCPYYEPREPKRSKCEET-EGCPQ-LVCDACGAGFSATDKFKTHVASHGLKLFPCEHCDDLFQNIDAWTRHVRIEHDSNLL 475          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|913328383|ref|XP_013195699.1| (PREDICTED: zinc finger and SCAN domain-containing protein 10-like [Amyelois transitella])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 334/514 (64.98%), Postives = 404/514 (78.60%), Query Frame = 0
Query:    1 MDEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYD------------------------DIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPT----------GEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASLF 480
            M++++F GCISC+S+NDLCDLFA Y+ NE+TYAKMFETCFDIK+ N +K+IC++C+E LE ++AFK+QT KN+A  +S+KDEEYLDETILEE  G   +D  +G+    + DD++  D                        DI+DE+A+QSLD+T CIYC LQL + +   EHIR+VHE+EPRTG+ L++C+LCG+ M  P+DH +RCH + S+ EGR+YPCHFC+N+Y++KKACFTHLRMKHGLKL N QT K   RERKKCH+C+RDFSQKQILNKHL KAHG EVEKRKAF CPLCDERVSYGSHFS+HLLH H V EQVE+LEFY+MDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTET+DRVLVTFYKTHVGHGPCPYFEPREPKKLK E             ++   +WICD+CG+ F +  +F  HV GH   S+ C +C +DFQD+E WTHHI+ +H++   +
Sbjct:    1 MEDQEFAGCISCLSSNDLCDLFAVYSVNEDTYAKMFETCFDIKIENGMKHICSMCIEKLESSSAFKQQTLKNIAFIKSLKDEEYLDETILEEELGE--EDIASGEDAAQDTDDEEYLDETILEEELGEEDIASGEDAAQDTDDIEDEYAVQSLDETRCIYCPLQLSSVDEAHEHIRAVHELEPRTGLPLKKCSLCGISMKDPSDHLNRCHTMNSDAEGRQYPCHFCENVYSTKKACFTHLRMKHGLKLGNAQTVKYVQRERKKCHMCSRDFSQKQILNKHLLKAHGLEVEKRKAFSCPLCDERVSYGSHFSSHLLHTHNVCEQVEQLEFYTMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETLDRVLVTFYKTHVGHGPCPYFEPREPKKLKTETLVSHCESNEDPNDNGGHSWICDTCGIEFYDGGEFNMHVAGHG-LSISCQFCGEDFQDMETWTHHIQSQHSIGGCY 511          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|930672571|gb|KPJ13152.1| (hypothetical protein RR48_01423 [Papilio machaon])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 328/478 (68.62%), Postives = 391/478 (81.80%), Query Frame = 0
Query:    2 DEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASL 479
            +EEDFVGCISCM+  DLCDLFA YA+NEETYA+M ++C++IK++ + K+IC+ CVE LEKAAAFK QT+KN+A+ QSIKDEEYLDE+ILEE +    D +      T  +D DD    I++EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG ++REC+LCG  ++  ADH +RCH   SE E R+Y CHFCDN+Y+SKKACFTHLRMKHGLKLCND TPK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF +MDDFMLFKSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHG CPY+EPREPK+ K E   E  P+  +CD+CG GF   DKF+ HV  H     PC +C   FQ+I+AWT H+R+EH+ + L
Sbjct:    3 EEEDFVGCISCMNNKDLCDLFAIYADNEETYAQMLKSCYNIKISTEYKFICSDCVEKLEKAAAFKSQTSKNLAMLQSIKDEEYLDESILEEGESLTVDCRHKNNHLTSTEDADD----INEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGQRVRECSLCGASLSDLADHINRCHSA-SESENRQYACHFCDNVYSSKKACFTHLRMKHGLKLCNDHTPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGTMDDFMLFKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGTCPYYEPREPKRAKCEE-AEGCPQ-LVCDACGAGFSATDKFKTHVASHGLKLFPCEHCDDLFQNIDAWTRHVRIEHDTSLL 473          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|930663094|gb|KPJ04700.1| (hypothetical protein RR46_01189 [Papilio xuthus])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 320/455 (70.33%), Postives = 378/455 (83.08%), Query Frame = 0
Query:    2 DEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYC 456
            +EEDFVGCISCM+  DLCDLFA YA+NEETYA+M ++C++IK++ + K+IC+ CVE LEKA+AFK QT+KN+A+ QSIKDEEYLDE+ILEE +G   D +G   S   + +D    DDI++EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG ++REC+LCG  ++  ADH +RCH   SE E R+Y CHFCDN+YNSKKACFTHLRMKHGLKLCND TPK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF +MDDFMLFKSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHG CPY+EPREPK+ K E T E  P+  +CD+CG GF   DKF+ HV  H     PC +C
Sbjct:    3 EEEDFVGCISCMNNKDLCDLFAIYADNEETYAQMLKSCYNIKISTEYKFICSDCVEKLEKASAFKNQTSKNLAMLQSIKDEEYLDESILEEGEGLTVDYRGNKTSHLTSTED---VDDINEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGQRVRECSLCGASLSDLADHINRCHSATSESESRQYACHFCDNVYNSKKACFTHLRMKHGLKLCNDHTPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGTMDDFMLFKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGTCPYYEPREPKRSKCEET-EGCPQ-LVCDACGAGFSATDKFKTHVASHGLKLFPCEHC 452          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|943956363|ref|XP_014361048.1| (PREDICTED: zinc finger protein 423-like [Papilio machaon])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 318/467 (68.09%), Postives = 380/467 (81.37%), Query Frame = 0
Query:   13 MSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASL 479
            M+  DLCDLFA YA+NEETYA+M ++C++IK++ + K+IC+ CVE LEKAAAFK QT+KN+A+ QSIKDEEYLDE+ILEE +    D +      T  +D DD    I++EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG ++REC+LCG  ++  ADH +RCH   SE E R+Y CHFCDN+Y+SKKACFTHLRMKHGLKLCND TPK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF +MDDFMLFKSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHG CPY+EPREPK+ K E   E  P+  +CD+CG GF   DKF+ HV  H     PC +C   FQ+I+AWT H+R+EH+ + L
Sbjct:    1 MNNKDLCDLFAIYADNEETYAQMLKSCYNIKISTEYKFICSDCVEKLEKAAAFKSQTSKNLAMLQSIKDEEYLDESILEEGESLTVDCRHKNNHLTSTEDADD----INEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGQRVRECSLCGASLSDLADHINRCHSA-SESENRQYACHFCDNVYSSKKACFTHLRMKHGLKLCNDHTPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGTMDDFMLFKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGTCPYYEPREPKRAKCEE-AEGCPQ-LVCDACGAGFSATDKFKTHVASHGLKLFPCEHCDDLFQNIDAWTRHVRIEHDTSLL 460          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|357627105|gb|EHJ76910.1| (hypothetical protein KGM_12826 [Danaus plexippus])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 317/501 (63.27%), Postives = 372/501 (74.25%), Query Frame = 0
Query:    2 DEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRK---AFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQ-------------------GKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASLF 480
            +EEDFVGCI+CMSTNDLCDLF  YA NEETYA+M ETCF+IKVTND KYICA+CVE LEK+  FK+QT K++ + QSIK+EEYLDE I +     +PD   + K+  + +D        D+EH I++LD+T CIYC+LQL ++E V  H+R  H +EPRTG ++ +C LCG  +   ADH +RCH   SE E R+Y CHFCDN+YNSKKACFTHLRMKHGLKLCND TPK ++R+RKKCH+C RDFSQKQILN HLWKAHGFEV        F CPLC ERVSYG++FSAHL   H V E VE+LEF SMDDFML+KSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQ                   GKGKRPAPERQIYKTGKACPAHMIVTET+DRVLVTFYKTHVGHG CPY+EPR+PK+ KQE       +A +CD+CG   +   + R HV  H  H  PC YC Q FQ+I+AWT H R EH + SLF
Sbjct:    8 EEEDFVGCITCMSTNDLCDLFVNYANNEETYAQMLETCFEIKVTNDFKYICAICVEKLEKSYEFKDQTVKSIDMLQSIKEEEYLDEAIFD-----DPDKDKSRKADLNYED--------DEEHEIEALDETRCIYCDLQLGSSEEVQHHVRLRHGLEPRTGRRVTQCHLCGASLRDLADHINRCHS-SSETE-RQYGCHFCDNVYNSKKACFTHLRMKHGLKLCNDHTPKYSSRDRKKCHICGRDFSQKQILNNHLWKAHGFEVSFHLFAFRFFCPLCSERVSYGANFSAHLTQQHDVTEDVEQLEFSSMDDFMLYKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQVRTGRRLAGSRPVWCGRHKGKGKRPAPERQIYKTGKACPAHMIVTETLDRVLVTFYKTHVGHGTCPYYEPRDPKRSKQE------EQALVCDTCG-ARVAAGRLRAHVAAHGLHLFPCDYCDQLFQNIDAWTQHTRTEHAVGSLF 486          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|910341264|ref|XP_013174338.1| (PREDICTED: zinc finger protein 699-like isoform X2 [Papilio xuthus])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 283/405 (69.88%), Postives = 329/405 (81.23%), Query Frame = 0
Query:   75 VFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASL 479
            + QSIKDEEYLDE+ILEE +G   D +G   S   + +D    DDI++EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG ++REC+LCG  +   ADH +RCH   SE E R+Y CHFCDN+YNSKKACFTHLRMKHGLKLCND TPK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF +MDDFMLFKSAIQEETK+RFRKTTASKQTIEGVRSHYMCSQSG+YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHG CPY+EPREPK+ K E T E  P+  +CD+CG GF   DKF+ HV  H     PC +C   FQ+I+AWT H+R+EH+   L
Sbjct:    1 MLQSIKDEEYLDESILEEGEGLTVDYRGNKTSHLTSTED---VDDINEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGQRVRECSLCGASLNDLADHINRCHSATSESESRQYACHFCDNVYNSKKACFTHLRMKHGLKLCNDHTPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGTMDDFMLFKSAIQEETKFRFRKTTASKQTIEGVRSHYMCSQSGIYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGTCPYYEPREPKRSKCEET-EGCPQ-LVCDACGAGFSATDKFKTHVASHGLKLFPCEHCDDLFQNIDAWTRHVRIEHDSNLL 400          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|827544679|ref|XP_012544969.1| (PREDICTED: zinc finger protein 816-like, partial [Bombyx mori])

HSP 1 Score: 491.886 bits (1265), Expect = 2.118e-170
Identity = 239/319 (74.92%), Postives = 255/319 (79.94%), Query Frame = 0
Query:  156 EIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEPREPKKLK------------QEPTGEDSP------EAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYC 456
            +IE   G    ECT+CGV +  P DH +RCH +KSEIEGRKY CHFCDN+Y SKKACFTHLRMKHGLKLCNDQTPK   RERKKCHLC+RDFSQKQILNKHL KAHG EVEKRKAFICPLCDERVSYGS+FSAHLLH HRV E VE+LEF+ MDDFM++KSAIQEETKYRFRKTTASKQTIEG+RSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTET DRVLVTFYKTHVGHGPCPYFEPREPKK K             EP  E+        EA ICD+CGM F   DKFR H+  H      C YC
Sbjct:   18 QIEALDGTMFTECTICGVTVRDPDDHKNRCHSLKSEIEGRKYSCHFCDNVYISKKACFTHLRMKHGLKLCNDQTPKFVVRERKKCHLCSRDFSQKQILNKHLMKAHGIEVEKRKAFICPLCDERVSYGSNFSAHLLHVHRVHEHVEQLEFHDMDDFMIYKSAIQEETKYRFRKTTASKQTIEGIRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETTDRVLVTFYKTHVGHGPCPYFEPREPKKPKPDCSSAESSMHEMEPKAENEADEMAETEALICDACGMAFYAIDKFRGHIATHGLEMYSCQYC 336          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|909566228|ref|XP_013138472.1| (PREDICTED: zinc finger protein Gfi-1b-like [Papilio polytes])

HSP 1 Score: 481.871 bits (1239), Expect = 2.828e-166
Identity = 225/333 (67.57%), Postives = 274/333 (82.28%), Query Frame = 0
Query:    2 DEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQ 334
            +EEDFVGCISCM+  DLCDLFA YA+NEETYA+M ++C++IK+T + K+IC+ CVE LEKAAAFK QT KN+A+ QSIKDEEYLDE+ILEE +    D +    S   + +D    DDI +EH IQ+LD+T CIYC +QLPTAE + +H+R VH +EPRTG+++REC+LCG  ++  ADH +RCH   SE E R+Y CHFC+N+YNSKKACFTHLRMKHGLKLCND +PK +  +RKKCH+C RDFSQKQILN HLWKAHG+EVEKRKAF CPLC+ERVSYG++FSAHLLH H+V EQVE+LEF SMDDFMLFKSAIQEETK+RFRKTT +KQ
Sbjct:    3 EEEDFVGCISCMNNKDLCDLFAVYADNEETYAQMLKSCYNIKITTEYKFICSDCVEKLEKAAAFKNQTNKNLAMLQSIKDEEYLDESILEEGETMTVDHRLNKTSHLASTED---ADDIKEEHEIQALDETTCIYCNVQLPTAEEIDQHVRMVHGLEPRTGLRVRECSLCGASLSDLADHINRCHSATSESESRQYACHFCENVYNSKKACFTHLRMKHGLKLCNDHSPKYSPTDRKKCHICQRDFSQKQILNNHLWKAHGYEVEKRKAFFCPLCNERVSYGTNFSAHLLHRHQVREQVEQLEFGSMDDFMLFKSAIQEETKFRFRKTTDTKQ 332          
BLAST of HiSeq13353 vs. genbank:protein
Match: gi|768439734|ref|XP_011561514.1| (PREDICTED: PR domain zinc finger protein 15-like [Plutella xylostella])

HSP 1 Score: 460.299 bits (1183), Expect = 7.051e-156
Identity = 249/507 (49.11%), Postives = 318/507 (62.72%), Query Frame = 0
Query:    1 MDEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKYICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDDKGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEHIRSVHEIEPRTGMKLRECTLCGVLMTRP---ADHADRCHGIKSEIEG--RKYPCHFCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQKQILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQVEELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGVYVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPCPYFEP-------------REPKKLKQEPT---------GEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHSLPCHYCPQDFQDIEAWTHHIRVEHNMASLF 480
            M+ E+F GCISCM T DLCDLF  Y EN +TYAKMFETCF++K+ +++K+IC+ C   L+ A  F+E T K + + Q IKDEEYLDE +LE  D            KT+   +    D  DD      +   +C + + + P                         C +C  +        +H +R HGI   I G  ++YPCHFC+N+Y+ +KAC+THLRMKHGLKL  +Q PK T R+RK+CH+CN+DFSQ+QILNKHLWKAHG+EVEKRKAF CPLC+ RVSYG HF  HLL  HR+ + VE L+F SMDDF+++KS +QE+T+ RFRKTTASK TIEG+RSHYMCSQSGVYVYQGKG RPAPERQIYKTGKACPAH++VTE++  V V F+ THVGHG CPY+EP             R P       T          +DS   W+CD+CG    +  +F  H + H    LPC YC   F++IE  T H+R EHN+ +  
Sbjct:    1 MEVEEFEGCISCMKTKDLCDLFTVYGENAQTYAKMFETCFNVKIADELKFICSTCAHKLQNACTFRELTLKTINMVQVIKDEEYLDEELLEADD------------KTEVKPEIGDDDPDDDSTKASGIRVGLCSHMDNRHP-------------------------CDMCAAVFASARTLKEHKERSHGIHGTIGGESKQYPCHFCENVYSGRKACYTHLRMKHGLKLSTEQAPKFTPRQRKQCHVCNKDFSQQQILNKHLWKAHGYEVEKRKAFQCPLCESRVSYGHHFDQHLLTEHRLKQHVETLQFPSMDDFIMYKSQVQEQTRCRFRKTTASKHTIEGLRSHYMCSQSGVYVYQGKGIRPAPERQIYKTGKACPAHIVVTESVGGVRVVFHSTHVGHGACPYYEPRESRKSKSESSLDRCPGLSPGSATYDPDDLDQDLDDSEREWLCDTCGESCDSARQFATHCDAHSCRLLPCIYCDSVFENIEWLTKHLRSEHNIGTFM 470          
The following BLAST results are available for this feature:
BLAST of HiSeq13353 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910341262|ref|XP_013174337.1|0.000e+069.25PREDICTED: zinc finger protein CG2199-like isoform... [more]
gi|913328383|ref|XP_013195699.1|0.000e+064.98PREDICTED: zinc finger and SCAN domain-containing ... [more]
gi|930672571|gb|KPJ13152.1|0.000e+068.62hypothetical protein RR48_01423 [Papilio machaon][more]
gi|930663094|gb|KPJ04700.1|0.000e+070.33hypothetical protein RR46_01189 [Papilio xuthus][more]
gi|943956363|ref|XP_014361048.1|0.000e+068.09PREDICTED: zinc finger protein 423-like [Papilio m... [more]
gi|357627105|gb|EHJ76910.1|0.000e+063.27hypothetical protein KGM_12826 [Danaus plexippus][more]
gi|910341264|ref|XP_013174338.1|0.000e+069.88PREDICTED: zinc finger protein 699-like isoform X2... [more]
gi|827544679|ref|XP_012544969.1|2.118e-17074.92PREDICTED: zinc finger protein 816-like, partial [... [more]
gi|909566228|ref|XP_013138472.1|2.828e-16667.57PREDICTED: zinc finger protein Gfi-1b-like [Papili... [more]
gi|768439734|ref|XP_011561514.1|7.051e-15649.11PREDICTED: PR domain zinc finger protein 15-like [... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0046872 metal ion binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012934Zinc finger, AD-typeSMARTSM00868zf-ADcoord: 8..79
e-value: 0.057
score: 16.7
coord: 239..300
e-value: 2.3
score: 5.9
IPR012934Zinc finger, AD-typePFAMPF07776zf-ADcoord: 9..77
e-value: 5.3E-6
score: 26.2
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 424..446
e-value: 1.7
score: 17.7
coord: 132..155
e-value: 13.0
score: 12.3
coord: 271..294
e-value: 6.2
score: 15.1
coord: 238..261
e-value: 20.0
score: 10.6
coord: 197..220
e-value: 1.1
score: 18.2
coord: 451..474
e-value: 0.84
score: 18.7
NoneNo IPR availablePANTHERPTHR24375:SF106HERMAPHRODITE-RELATEDcoord: 134..294
coord: 416..472
NoneNo IPR availablePANTHERPTHR24375FAMILY NOT NAMEDcoord: 134..294
NoneNo IPR availablePANTHERPTHR24375FAMILY NOT NAMEDcoord: 416..472
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 240..261
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 134..155
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 199..220
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 453..474
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 273..294
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 426..448
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 238..266
score: 9.307

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13353HiSeq13353Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13353_p ID=HiSeq13353_p|Name=HiSeq13353|organism=Ostrinia scapulalis|type=polypeptide|length=480bp
MDEEDFVGCISCMSTNDLCDLFAAYAENEETYAKMFETCFDIKVTNDIKY
ICAVCVENLEKAAAFKEQTTKNMAVFQSIKDEEYLDETILEEADGSNPDD
KGAGKSKTDNDDDDDMYDDIDDEHAIQSLDDTICIYCELQLPTAEMVGEH
IRSVHEIEPRTGMKLRECTLCGVLMTRPADHADRCHGIKSEIEGRKYPCH
FCDNIYNSKKACFTHLRMKHGLKLCNDQTPKLTTRERKKCHLCNRDFSQK
QILNKHLWKAHGFEVEKRKAFICPLCDERVSYGSHFSAHLLHAHRVFEQV
EELEFYSMDDFMLFKSAIQEETKYRFRKTTASKQTIEGVRSHYMCSQSGV
YVYQGKGKRPAPERQIYKTGKACPAHMIVTETMDRVLVTFYKTHVGHGPC
PYFEPREPKKLKQEPTGEDSPEAWICDSCGMGFLNEDKFREHVEGHQHHS
LPCHYCPQDFQDIEAWTHHIRVEHNMASLF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
GO:0008270zinc ion binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR007087Znf_C2H2
IPR015880Znf_C2H2-like
IPR012934Znf_AD