HiSeq13364_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13364
Unique NameHiSeq13364_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length320
Homology
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|930678069|gb|KPJ18047.1| (Chymotrypsin [Papilio machaon])

HSP 1 Score: 164.081 bits (414), Expect = 9.706e-46
Identity = 97/242 (40.08%), Postives = 135/242 (55.79%), Query Frame = 0
Query:   41 MEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKK-ALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETED--KKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFV-KRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            ME  +V GD+  I++YPH   L + C        + CGSS+INQ   LTAAHCL+ C      I    GH  +K+ ++  +    +IH+KY D+ +  DI LV L   L LG K++RV L+K +         VAGWG   D  ++G + LK   Q + S K CTK    +L  G +CAG   K      +GDSGSAL+   Y QIGIVSY+ V   P ++VYT+VS++Y+WI   +R M+C
Sbjct:    1 MESFVVNGDFAKIKQYPHCVFLVVNCR-----GKWICGSSVINQKILLTAAHCLY-CASTNPKIDAFAGHENIKQTSVNRAVKKVLIHDKYSDRNVNSDIGLVMLSEDLPLGKKIKRVILVKQSNYG--LSAVVAGWGAISDEPERGTDTLKWANQKVRSEKTCTKL--GKLKPGMMCAGSTSKEHPRPSKGDSGSALITANYQQIGIVSYRLVTY-PGLVVYTNVSYYYDWIKEKSRLMYC 231          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|357629801|gb|EHJ78353.1| (hypothetical protein KGM_12839 [Danaus plexippus])

HSP 1 Score: 169.859 bits (429), Expect = 1.005e-45
Identity = 92/244 (37.70%), Postives = 145/244 (59.43%), Query Frame = 0
Query:   39 NQMEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETED--KKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHCKH 280
            N++EG +V GD V IE++P++A L +    G +  S+ CGSSIINQ   LTAAHC+  C+ +       VG+   +  +K +      H +Y    +  DI L  L   +  G  V+RVA+ +   + +V++  +AGWG  ++  K   +YL H+ Q + S  +C K + + +  G  CAG +K + +A +GDSGSAL+IN+Y QIGIVSYK    S S++VYT+VS +Y+WI   +R+++C +
Sbjct:  197 NELEGRVVRGDVVSIEDFPYSAFLLM----GRERGSFICGSSIINQRILLTAAHCIEICNPKCKNGAAFVGNEQKRMGIKMTITFAKYHPRYRTNRVHFDIGLALLSRSIKFGKFVKRVAISRRPRIKSVAD--IAGWGLVDEINKLSTDYLHHITQKVISHSDC-KAYISNIPPGSFCAGEIKSRQFASEGDSGSALIINKYTQIGIVSYKRPDISASLIVYTNVSFYYDWIKQTSRKLYCDY 433          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|930659389|gb|KPJ01456.1| (Chymotrypsin [Papilio xuthus])

HSP 1 Score: 163.31 bits (412), Expect = 1.971e-45
Identity = 96/242 (39.67%), Postives = 135/242 (55.79%), Query Frame = 0
Query:   41 MEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKK-ALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETED--KKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFV-KRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            ME  +V GD+  I++YPH   L + CH       + CGSS++NQ   LTAAHCL  C   +  I    GH  +K+ ++  +    +IH+KY D+ +  DI LV L   L LG K++RV L+K +         VAGWG   D  ++G + LK   Q + S K CTK    +L  G +CAG   K      +GDSGSAL+   Y QIGIVSY+ +   P ++VYT+VS++Y WI   +R M+C
Sbjct:    1 MEPFVVNGDFAKIKQYPHCVFLVVDCH-----GKWICGSSVVNQKILLTAAHCLF-CANTKPKIDAFAGHENIKQTSVNRAVKKLLIHDKYSDRNVNSDIGLVMLSEDLPLGKKIKRVILVKQSNYG--LSAVVAGWGAISDEPERGTDTLKWANQKVRSEKTCTKL--GKLKPGMMCAGSTSKEHPRPSKGDSGSALITANYEQIGIVSYRLMTY-PGLVVYTNVSYYYEWIKEKSRLMYC 231          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|913304487|ref|XP_013201190.1| (PREDICTED: chymotrypsin-1-like [Amyelois transitella])

HSP 1 Score: 163.31 bits (412), Expect = 3.615e-45
Identity = 90/248 (36.29%), Postives = 140/248 (56.45%), Query Frame = 0
Query:   37 GNNQMEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETEDKKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHCKHRQHA 284
              + +   I GG++ + ++YPH+  L I C K        CG SI+NQ+  LTAAHC+ +C I    I++  G+  + +  ++S    + HE Y+D  +  DIALV  K  + L S V+RV L+K    P V++ +V+GWG  E    +  LKH    +   K C +  G+ +  G  CAG +     A++GDSGSALVIN+YIQIGIVSYK   +  +++ YT+VS+F +WI  ++  + C +   +
Sbjct:   16 AKSDLVSFITGGEFAEYDQYPHSVLLVIYCQKDAM-----CGGSILNQNLVLTAAHCVDDC-IEEDNILVKYGNKMIYEMKQTSTKKTVYHEDYDDFYMLNDIALVLTKERIPLDSVVKRVILMKSP--PVVTDAYVSGWGVDEYNVVSQALKHTTALVRDAKTCVQVMGS-IPNGTFCAGPITGIGAANRGDSGSALVINKYIQIGIVSYKL--KDYTLVTYTNVSYFMDWIQVNSVELFCYNETES 252          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|943940803|ref|XP_014371861.1| (PREDICTED: chymotrypsin-like [Papilio machaon])

HSP 1 Score: 161.77 bits (408), Expect = 8.596e-45
Identity = 98/244 (40.16%), Postives = 135/244 (55.33%), Query Frame = 0
Query:   41 MEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKA-LKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLK---PNEVPNVSEGFVAGWGETE--DKKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            ME +++GGD+ DI  +PH+  L I C       +Y CGSSI+NQ   LTAAHC+++C  RR  I    GH  L K  +  +    + HEKY DQ +  DIAL+ L+  L LG  +QRV + +   PNE+ +     VAGWG       K   +LK   Q L S + C  F G  +  G +CA   ++      GDSGSAL+     QIG+VSY F    P++ +YT+VSH+YNWI   +R +HC
Sbjct:    1 MEPYVIGGDFTDISHFPHSVFLNIDCM-----TTYICGSSILNQKILLTAAHCINDCK-RRWQIEGYAGHENLSKVKVMRTIKKILKHEKYNDQSMANDIALLYLERSLPLGKYIQRVTIRRWHSPNEIAS-----VAGWGIVNRVTNKDTIHLKRALQKLISPRVCASFGG--MFTGMMCAKSPEKNTSPASGDSGSALITKDMQQIGLVSYIF-SEYPNMPIYTNVSHYYNWINTKSRSLHC 230          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|914570866|gb|KOB74133.1| (Uncharacterized protein OBRU01_02157 [Operophtera brumata])

HSP 1 Score: 161.384 bits (407), Expect = 1.409e-44
Identity = 98/242 (40.50%), Postives = 138/242 (57.02%), Query Frame = 0
Query:   41 MEGHIVGGDYVDIEEYPHAACLAITC--HKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETEDK-KGNNYLKHVRQPLWSRKNCTKFFGA-ELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            MEG IVGG+Y  I  + HAA L I C   + +   S+ CG+SIINQ   LTAAHCL +C  ++S I I VG    +K      N F+IH  Y+ +    DI LVQ+++PLTL     RVAL + +     +   V+GWG  +D  + +  LK V Q + SR  C +      + +G ICA       +A +GDSGSALV+  Y+QIGIVSY+ +  +  I +YTDV +FY+WI    + ++C
Sbjct:    1 MEGFIVGGEYAKIVNHAHAAFLHIDCVSREHFSFGSWSCGASIINQKSLLTAAHCLRDCG-KQSRIKIHVGSENWQKGQIYDCNRFVIHFNYDPRSSTNDICLVQVQSPLTLSRNSSRVALTRRHMHEETAT--VSGWGMFDDSGEMSELLKFVTQKVMSRIKCIRALSFHAVGVGTICATAEHNDGHAARGDSGSALVVRGYVQIGIVSYR-ITNAKHIAIYTDVCYFYDWIVAVAKELNC 238          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|910334530|ref|XP_013170700.1| (PREDICTED: chymotrypsin-like [Papilio xuthus])

HSP 1 Score: 156.377 bits (394), Expect = 1.958e-42
Identity = 98/262 (37.40%), Postives = 142/262 (54.20%), Query Frame = 0
Query:   23 LLVFHILNYCSSICGNNQMEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKA-LKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLK---PNEVPNVSEGFVAGWGETE--DKKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
             ++F  + Y  S   NN ME +++GGD+ DI  +PH+  L I C      +++ CGSSI+NQ   LTAAHC+  C  R+  I    GH  L K  +  + N  ++HE ++DQ +  DIAL+ L   L LG  +QRV + K   P+E+ +     VAGWG       K + YLK   Q + S + C +F G  +  G +CA   ++      GDSGSAL+     QIG+VSY F    P + +YT+VSH+Y WI   +  +HC
Sbjct:    8 FVLFMCITYARS---NNTMEPYVIGGDFTDITHFPHSVFLNIDCM-----STWICGSSILNQRILLTAAHCITGCK-RQWKIEGYAGHENLSKVKVMRTVNKILMHENFDDQSMANDIALLYLVKSLPLGKYIQRVTIRKWHSPSEIAS-----VAGWGIVNRVTNKDSIYLKRALQRVMSPRLCARFGG--MYSGMMCAKSPEKNTSPASGDSGSALITKDMQQIGLVSYIF-SEYPEMPIYTNVSHYYFWIKTKSISLHC 252          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|913304489|ref|XP_013201191.1| (PREDICTED: serine protease 52-like [Amyelois transitella])

HSP 1 Score: 150.984 bits (380), Expect = 1.444e-40
Identity = 86/240 (35.83%), Postives = 139/240 (57.92%), Query Frame = 0
Query:   41 MEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRS-YIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVP-NVSEGFVAGWGETEDKKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            +E  + GGD+V+  EYPH+  +   C K     S+ CG S++NQ   LTAAHCL +C  ++   + +  GH  + +  K+    F+IHE+Y+  ++  DIALV+ K  + L   V+RV +++    P N    +VAGWG  E KK +  LKH +  + S++ C +   + +  G  CAG +     AD+GDSG ALVIN  IQIGIVS++   +  +++ YT+V+++++WI  +   + C
Sbjct:   15 LEAFVNGGDFVEYNEYPHSLFIINVCEK-----SFVCGGSVLNQELVLTAAHCLEDCVGKQEPKVQVRYGHKKIDRMSKTFLKKFVIHEQYDRFLVSNDIALVRTKERIPLNDNVKRVIIMR---YPLNERNAYVAGWGLDEFKKRSGLLKHTKALIQSQQACEENI-SFMPKGVFCAGPLSGIGAADRGDSGGALVINGCIQIGIVSFRIPDK--TLVAYTNVTYYWDWIHENALALFC 243          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|768446282|ref|XP_011565074.1| (PREDICTED: hypodermin-B-like [Plutella xylostella])

HSP 1 Score: 148.288 bits (373), Expect = 1.105e-38
Identity = 90/241 (37.34%), Postives = 135/241 (56.02%), Query Frame = 0
Query:   45 IVGGDYVDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETED--KKGNNYLKHVRQ-PLWSRKNCTKFFGAELSLGQICAGF----VKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHC 278
            IVGGDY DIEE+PH+  L+  C     ++S+ CGSS+INQ   L+AAHCL  C+    YI   +GH    K+       +  HEKY +  +  DI L++LK  L LG  V RV L+K    P   +G V+GWG  +D  +     LK +    ++SR+ C +     L  G ICA         + +  +GDSGSALV+ +YIQ+G++S++ + RS ++ VY+D  +F++WI    + + C
Sbjct:   23 IVGGDYTDIEEFPHSVFLSFRCQISNSTDSWICGSSVINQWLLLSAAHCLDGCEANHIYIAAKLGHTDRGKSQTRLVAKYKRHEKYNEMRLLNDICLLKLKEELKLGPTVMRVILMK--NPPYNEKGIVSGWGFIDDLNQVSTYKLKKLGNLTIYSREQCDRTLPG-LPAGVICAQLDAPPPGEEHHTARGDSGSALVVRKYIQVGLISFRELERSRTMTVYSDTGYFFHWIKNTAKDILC 260          
BLAST of HiSeq13364 vs. genbank:protein
Match: gi|914570863|gb|KOB74130.1| (Chymotrypsin-1 [Operophtera brumata])

HSP 1 Score: 142.51 bits (358), Expect = 1.312e-37
Identity = 87/244 (35.66%), Postives = 123/244 (50.41%), Query Frame = 0
Query:   39 NQMEGHIVGGDYVDIEEYPHAACLAITCHKGYQSNS--YKCGSSIINQHFTLTAAHCLHECDIRRSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTLGSKVQRVALLKPNEVPNVSEGFVAGWGETEDKKGNNYLKHVRQPLWSRKNCTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFVRRSPSILVYTDVSHFYNWITGHTRRMHCKH 280
            + MEG IVGG Y  I+ + H+  L I C     +++  + CG+S++NQ   L+AAHCLH+C   RS+I I VG+    +    S  SF+IHE Y  Q    DI LV++++PL    K  RVAL++    P   +  VAGWG                                             D ++ GDSGSAL++  YIQIG+VSYK    S  I+VYTDV +FY+WI  + R ++C +
Sbjct:   18 SAMEGFIVGGQYAKIDNFAHSVFLDIYCVSKVDNSTSGWICGASVVNQKILLSAAHCLHDCS-HRSHISIHVGNANSDRGQIYSLYSFVIHEGYNAQTNVNDICLVRVRSPLKFSRKASRVALMRAP--PYTEKATVAGWGVI-------------------------------------------DVSNIGDSGSALMVRGYIQIGLVSYKIPTISKRIVVYTDVGYFYDWIKVYARELNCNN 215          
The following BLAST results are available for this feature:
BLAST of HiSeq13364 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930678069|gb|KPJ18047.1|9.706e-4640.08Chymotrypsin [Papilio machaon][more]
gi|357629801|gb|EHJ78353.1|1.005e-4537.70hypothetical protein KGM_12839 [Danaus plexippus][more]
gi|930659389|gb|KPJ01456.1|1.971e-4539.67Chymotrypsin [Papilio xuthus][more]
gi|913304487|ref|XP_013201190.1|3.615e-4536.29PREDICTED: chymotrypsin-1-like [Amyelois transitel... [more]
gi|943940803|ref|XP_014371861.1|8.596e-4540.16PREDICTED: chymotrypsin-like [Papilio machaon][more]
gi|914570866|gb|KOB74133.1|1.409e-4440.50Uncharacterized protein OBRU01_02157 [Operophtera ... [more]
gi|910334530|ref|XP_013170700.1|1.958e-4237.40PREDICTED: chymotrypsin-like [Papilio xuthus][more]
gi|913304489|ref|XP_013201191.1|1.444e-4035.83PREDICTED: serine protease 52-like [Amyelois trans... [more]
gi|768446282|ref|XP_011565074.1|1.105e-3837.34PREDICTED: hypodermin-B-like [Plutella xylostella][more]
gi|914570863|gb|KOB74130.1|1.312e-3735.66Chymotrypsin-1 [Operophtera brumata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin-typePRINTSPR00722CHYMOTRYPSINcoord: 223..235
score: 45.59
coord: 134..148
score: 33.94
coord: 78..93
score: 48.47
IPR001254Peptidase S1SMARTSM00020Tryp_SPccoord: 44..269
e-value: 7.3E-38
score: 141.8
IPR001254Peptidase S1PFAMPF00089Trypsincoord: 45..269
e-value: 2.5E-38
score: 131.7
IPR001254Peptidase S1PROSITEPS50240TRYPSIN_DOMcoord: 45..274
score: 22.73
NoneNo IPR availableGENE3D2.40.10.10coord: 83..150
e-value: 1.3E-17
score: 63.2
NoneNo IPR availableGENE3D2.40.10.10coord: 151..274
e-value: 2.2E-31
score: 108.4
NoneNo IPR availableGENE3D2.40.10.10coord: 45..82
e-value: 6.1E-10
score: 38.3
NoneNo IPR availablePANTHERPTHR24268FAMILY NOT NAMEDcoord: 45..280
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..21
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 22..29
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 35..320
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 30..34
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..34
IPR018114Peptidase S1, trypsin family, active sitePROSITEPS00134TRYPSIN_HIScoord: 88..93
IPR009003Trypsin-like cysteine/serine peptidase domainSUPERFAMILY50494Trypsin-like serine proteasescoord: 24..274

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13364HiSeq13364Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13364_p ID=HiSeq13364_p|Name=HiSeq13364|organism=Ostrinia scapulalis|type=polypeptide|length=320bp
MKNNFKXEQVTNMKRTQRLRKLLLVFHILNYCSSICGNNQMEGHIVGGDY
VDIEEYPHAACLAITCHKGYQSNSYKCGSSIINQHFTLTAAHCLHECDIR
RSYIMISVGHHYLKKALKSSANSFMIHEKYEDQIIFPDIALVQLKTPLTL
GSKVQRVALLKPNEVPNVSEGFVAGWGETEDKKGNNYLKHVRQPLWSRKN
CTKFFGAELSLGQICAGFVKRKDYADQGDSGSALVINRYIQIGIVSYKFV
RRSPSILVYTDVSHFYNWITGHTRRMHCKHRQHANENGIVDFEDDDYPTV
NQEDNLLFVAPKPTRVVSYG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR009003Trypsin-like_Pept_dom
IPR018114Peptidase_S1_AS
IPR001254Peptidase_S1
IPR001314Peptidase_S1A