HiSeq13365_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13365
Unique NameHiSeq13365_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length643
Homology
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|913309792|ref|XP_013185498.1| (PREDICTED: uncharacterized protein LOC106131056 [Amyelois transitella])

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 495/642 (77.10%), Postives = 556/642 (86.60%), Query Frame = 0
Query:    1 MEDVIEEEVEWHGEQRSRHPANTEHYEHGLHHYHPHRQTSTSLERKIRHNREHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNETTMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            MEDVIEE+ EW  E +S  P+ +  YEHGLHH+HP +Q+ST+LERK+RHNREHP  PHSLPRLSVV P S++SS DNI  P P+ ++PLSHGDESMTVVLSAFYAKLLI+LGVA PVTSTIQNELYTNITSD+F MYLY++SM+FLAY FYHLRIAKKD KK+  KRTRYGSFYLH+GVAGF VGSIIYSCLQFG YFDLSGDC++ IVAVKPALRIL+MVAQTVFIFSYT  LD MRGV+LDRFGLMHLIATNVCEW NVVIQETRDDIV VAY+RP LLRYANI+   +TII DE DN TF+E  S +  TS +    NW+C+VSD++TPLIRSVNPYLR CGVEYSLLCS+I+ VIWND+CTVPG K  KK    PQ    E+++CC R+KS+ HFSVDCGSAHKGLF+G+A+LAGTIVSLMLFNGLFQN KH ELALLQ+N+WETILF++MT GSGAC+QRMR LP RRAV++LPLEH+LLLVTQ GVYLYYLFQIIGAGFLI RYPEGRRATRILSPLCA++QSSCQTLL+LD+W RRC  A    RPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYK  K S D I+ +E ELK
Sbjct:   10 MEDVIEEDEEWIAETQSLRPSTS--YEHGLHHFHPRKQSSTALERKLRHNREHP--PHSLPRLSVVLPTSSNSSVDNIPTPPPR-RQPLSHGDESMTVVLSAFYAKLLIILGVAFPVTSTIQNELYTNITSDVFAMYLYVVSMSFLAYIFYHLRIAKKD-KKEIEKRTRYGSFYLHIGVAGFGVGSIIYSCLQFGEYFDLSGDCRMAIVAVKPALRILFMVAQTVFIFSYTHKLDRMRGVILDRFGLMHLIATNVCEWFNVVIQETRDDIVEVAYERPTLLRYANITTGHKTIITDESDNLTFVETQSTSQNTSADL---NWSCNVSDVVTPLIRSVNPYLRNCGVEYSLLCSVILMVIWNDLCTVPGMKSVKKV---PQAIVKETKQCCERVKSSKHFSVDCGSAHKGLFVGIAILAGTIVSLMLFNGLFQNSKHEELALLQINIWETILFIMMTLGSGACLQRMRKLPLRRAVSSLPLEHSLLLVTQFGVYLYYLFQIIGAGFLIHRYPEGRRATRILSPLCAIIQSSCQTLLILDSWCRRCVEATTVHRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKRKKYSND-ISLEEIELK 638          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|827550941|ref|XP_012547392.1| (PREDICTED: uncharacterized protein LOC101735423 [Bombyx mori])

HSP 1 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 493/666 (74.02%), Postives = 554/666 (83.18%), Query Frame = 0
Query:    1 MEDVIEEEVEWH-GEQRSRHPANTEHYEHGLHHYHPHRQTSTSLERKIRHNREHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIE---------------HLSLANITSN------ETTMRN--WTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            MEDVI+E+ +   G+ +   P    H     HHYHP RQTST+LERKIRH+REHP  PH+LPRLSVV P+S+ SSTDNI +P P  KRPLSHGDESMTV LSAFYAKLLIVLG+ALPVTSTIQNELYTNITSDIFTMYLY+ISM FLAYTFYHLR+A++  K DNVKRTRYGSFYLH+GVAGF VGSIIYSCLQFG YFDLSGDCQL IVAVKP LRILY+VAQTVFIFSYTD+LDPMRGVV+DRFGLMHLIATNVCEWLNVV+Q+TRDDIV VAYD+P L RYANISG  Q  I D++DN T  E                  + ++++N        TM N  W C+VSDMITPLIR+VNPYLRPCGVEYSLLCS+IIAVIWND+CTVPGSK +KKS +       E ++CCAR+KSNNHFSVDCGSAHKGLFMG+AVLAGTIVSLMLFNGLFQ ++HVELALLQ+N+WETILFVLMT  S ACIQRMR LP R+AV++L LEHALLLVTQCGVYLYYLFQIIG GFL++RY EG RATRI+SPLCA++QSSCQTLLVLDAW+RR + + G +RPGRQL+TFLLVGNFALWLLNRVKN RAEFHPLQMEFYGVWAWTLITHVS PLLVCYRFQATVC YE+WKNSYK  K+  +    +EFELK
Sbjct:    1 MEDVIQEDTQCRTGDTK---PITYGHS----HHYHPVRQTSTTLERKIRHSREHP--PHALPRLSVVLPSSSGSSTDNIPSPLPS-KRPLSHGDESMTVALSAFYAKLLIVLGIALPVTSTIQNELYTNITSDIFTMYLYVISMLFLAYTFYHLRMARR-YKDDNVKRTRYGSFYLHIGVAGFGVGSIIYSCLQFGEYFDLSGDCQLTIVAVKPVLRILYLVAQTVFIFSYTDVLDPMRGVVIDRFGLMHLIATNVCEWLNVVVQDTRDDIVDVAYDQPILFRYANISGHKQIDINDKLDNLTIEEIVDYPKPLLSVFNNNRTDIGSVSTNLSFKYFNATMNNDIWICNVSDMITPLIRNVNPYLRPCGVEYSLLCSVIIAVIWNDLCTVPGSKPSKKSKAFK-----EIKQCCARVKSNNHFSVDCGSAHKGLFMGIAVLAGTIVSLMLFNGLFQKKQHVELALLQINIWETILFVLMTIASAACIQRMRALPLRKAVSSLQLEHALLLVTQCGVYLYYLFQIIGTGFLLKRYSEGSRATRIISPLCAVIQSSCQTLLVLDAWARR-STSNGRQRPGRQLITFLLVGNFALWLLNRVKNGRAEFHPLQMEFYGVWAWTLITHVSAPLLVCYRFQATVCLYEVWKNSYK-RKNIGEYNDTNEFELK 648          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|910342618|ref|XP_013175045.1| (PREDICTED: uncharacterized protein LOC106123335 [Papilio xuthus] >gi|910342620|ref|XP_013175046.1| PREDICTED: uncharacterized protein LOC106123335 [Papilio xuthus])

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 453/593 (76.39%), Postives = 506/593 (85.33%), Query Frame = 0
Query:   52 EHPHPPHSLPRLSVVPPASNSSSTDNIAAPAP-KPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNET-TMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            E   PPH+LPRLSVV P S++SS +    PAP KP+ PLSHGDESMTVVLSAFYAKLLIVLG+ALPVTSTIQNEL TN+TSDIFT+YLYI+SM FLAYTFYHL   KK  K  NVKRTRYGSFYLH+GVAGFSVGSIIYSCLQ   YFDLSGDCQ+++VA+KP LRIL+MVAQ+VFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNV+IQETRDDI+AVAY+ P  +RY  I+ P ++       N  + E  +  NI+ N T     W+C++S++ITPLIRS NPYLRPCGVEYSLLCSIII VIWNDICTVPGSK     NS+   F  + ++CCAR+KSNNHFSVDCGSAHKGLFMG+AVLAGTIVSLMLFNGLFQ  KHVELALLQ+N+WET+LFV+MT GSGACIQRMR L  R+    +PLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRI++PLCA++QSSCQ+LLVLDAWSRRCAG   G RPGRQLVTFLLVGNFALWLLNRVKNARAE+HPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT K    +  ++EFELK
Sbjct:   33 ESELPPHTLPRLSVVLPCSSTSSIE----PAPNKPRSPLSHGDESMTVVLSAFYAKLLIVLGLALPVTSTIQNELVTNVTSDIFTIYLYIVSMLFLAYTFYHLSRVKKS-KDVNVKRTRYGSFYLHIGVAGFSVGSIIYSCLQIAEYFDLSGDCQIIMVALKPTLRILFMVAQSVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVIIQETRDDIIAVAYNSPPFIRYTAIAEPTKSPFATRDKNYLY-EDYNSTNISENTTMAAATWSCNISNIITPLIRSANPYLRPCGVEYSLLCSIIIVVIWNDICTVPGSKPLNDVNSN-AVFTKDVKQCCARVKSNNHFSVDCGSAHKGLFMGIAVLAGTIVSLMLFNGLFQKDKHVELALLQINIWETVLFVIMTIGSGACIQRMRLLTLRKISTTMPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRIIAPLCAVIQSSCQSLLVLDAWSRRCAGT--GGRPGRQLVTFLLVGNFALWLLNRVKNARAEYHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT-KSHTSIRDDNEFELK 615          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|943944988|ref|XP_014355788.1| (PREDICTED: uncharacterized protein LOC106708752 [Papilio machaon] >gi|943944990|ref|XP_014355789.1| PREDICTED: uncharacterized protein LOC106708752 [Papilio machaon] >gi|943944993|ref|XP_014355790.1| PREDICTED: uncharacterized protein LOC106708752 [Papilio machaon])

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 451/592 (76.18%), Postives = 503/592 (84.97%), Query Frame = 0
Query:   52 EHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNETT-MRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            E  HPPH LPRLSVV P S++SS D+  AP  KP+  LSHGDESMTVVLSAFYAKLLIVLG+ALPVTSTIQNEL TNITSDIFTMYLY++SM FLAYTFYHL   KK+ K  NVKRTRYGSFYLH+GVAGFSVGSIIYSCLQ   YFDLSGDCQ++IVA+KP LRIL+MVAQ+VFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNV+IQETRDDI+AVAY+    +RY  I  P ++ I          +  +  +I+ N T  + NW+C++SD+ITPLIRS NPYLRPCGVEYSLLCSIII VIWNDICTVPGSK     NS+   +  + ++CC RIKSNNHFSVDCGSAHKGLFMG+AVLAGTIVSLMLFNGLFQ  KH ELALLQ+N+WET+LFV+MT GSGACIQRMR L  R+    +PLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPE RRATRI++PLCA++QSSCQ+LLVLDAWSRRCAG  G  RPGRQLVTFLLVGNFALWLLNRVKNARAE+HPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT  D+  +  ++EFELK
Sbjct:   33 ESEHPPHILPRLSVVLPCSSTSSVDH--APT-KPRSTLSHGDESMTVVLSAFYAKLLIVLGLALPVTSTIQNELVTNITSDIFTMYLYVVSMLFLAYTFYHLSRVKKN-KDVNVKRTRYGSFYLHIGVAGFSVGSIIYSCLQIAEYFDLSGDCQIIIVALKPTLRILFMVAQSVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVIIQETRDDIIAVAYNSLPFIRYTTIDKPTKSPIATSDKGNYLYQDYNSTSISKNITIPVENWSCNISDIITPLIRSANPYLRPCGVEYSLLCSIIIVVIWNDICTVPGSKPLNDVNSN-GIYTKDVKQCCTRIKSNNHFSVDCGSAHKGLFMGIAVLAGTIVSLMLFNGLFQKDKHEELALLQINIWETVLFVIMTIGSGACIQRMRLLTLRKISTTMPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEARRATRIIAPLCAIIQSSCQSLLVLDAWSRRCAGTGG--RPGRQLVTFLLVGNFALWLLNRVKNARAEYHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTKNDA-SIRDDNEFELK 616          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|909559181|ref|XP_013134634.1| (PREDICTED: uncharacterized protein LOC106100353 [Papilio polytes])

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 451/591 (76.31%), Postives = 505/591 (85.45%), Query Frame = 0
Query:   52 EHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNETTMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            E  HPPHSLPRLSVV P S++SS D+  AP  KP+ PLSHGDESMTVVLSAFYAKLLIVLG+ALPVTSTIQNEL TN+TSDIFTMYLYI+SM FL YTFYHL   KK      VKRTRYGSFYLH+GVAGFSVGSIIYSCLQ   YFDLSGDCQ++++A+KP LRIL+MVAQ+VFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNV+IQETRDDI+AVAY+ P  +RY  I  P ++ I  +  N    ++ S   I +   +   W+C++SD+ITPLIRSVNPYLRPCGVEYSLLCSIII VIWND+CTVPGSK     NS+   +  E ++CCAR+KSNNHFSVDCGSAHKGLFMG+AVLAGT+VSLMLFNGLFQ  KHVELALLQ+N+WET+LFV+MT GSGACIQRMR L  R+    +PLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRI++PLCA++QSSCQ+LLVLDAWSRRCAGA   RRPGRQLVTFLLVGNFALWLLNRVKNARAE+HPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT K+      ++EFELK
Sbjct:   33 EREHPPHSLPRLSVVLPCSSTSSVDH--APN-KPRSPLSHGDESMTVVLSAFYAKLLIVLGLALPVTSTIQNELVTNVTSDIFTMYLYIVSMLFLGYTFYHLSKVKKSKVS--VKRTRYGSFYLHIGVAGFSVGSIIYSCLQIAEYFDLSGDCQIIMIALKPTLRILFMVAQSVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVIIQETRDDIIAVAYNSPPFIRYTTIDEPTKSSIATDEANYFDQDYNSTDMIENITISTDTWSCNISDIITPLIRSVNPYLRPCGVEYSLLCSIIIVVIWNDLCTVPGSKPGNDVNSN-GVYTKEVKQCCARVKSNNHFSVDCGSAHKGLFMGIAVLAGTVVSLMLFNGLFQKDKHVELALLQINIWETVLFVIMTIGSGACIQRMRLLTLRKISTTMPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRIIAPLCAVIQSSCQSLLVLDAWSRRCAGA--SRRPGRQLVTFLLVGNFALWLLNRVKNARAEYHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT-KNYTSSRDDNEFELK 614          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|930676735|gb|KPJ16873.1| (Otopetrin-2 [Papilio machaon])

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 447/592 (75.51%), Postives = 499/592 (84.29%), Query Frame = 0
Query:   52 EHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNETT-MRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            E  HPPH LPRLSVV P S++SS D+  AP  KP+  LSHGDESMTVVLSAFYAKLLIVLG+ALPVTSTIQNEL TNITSDIFTMYLY++SM FLAYTFYHL   KK+ K  NVKRTRYGSFYLH+GVAGFSVGSIIYSCLQ   YFDLSGDCQ++IVA+KP LRIL+MVAQ+VFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNV+IQETRDDI+AVAY+    +RY  I  P ++ I          +  +  +I+ N T  + NW+C++SD+ITPLIRS NPYLRPCGVEYSLLCSIII VIWNDICTVPGSK     NS+   +  + ++CC RIKSNNHFSVDCGSAHKGLFMG+AVLAGTIVSLMLFNGLFQ  KH ELALLQ+N+WET+LFV+MT GSGACIQRMR L  R+    +PLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPE     RI++PLCA++QSSCQ+LLVLDAWSRRCAG   G RPGRQLVTFLLVGNFALWLLNRVKNARAE+HPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT  D+  +  ++EFELK
Sbjct:   32 ESEHPPHILPRLSVVLPCSSTSSVDH--APT-KPRSTLSHGDESMTVVLSAFYAKLLIVLGLALPVTSTIQNELVTNITSDIFTMYLYVVSMLFLAYTFYHLSRVKKN-KDVNVKRTRYGSFYLHIGVAGFSVGSIIYSCLQIAEYFDLSGDCQIIIVALKPTLRILFMVAQSVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVIIQETRDDIIAVAYNSLPFIRYTTIDKPTKSPIATSDKGNYLYQDYNSTSISKNITIPVENWSCNISDIITPLIRSANPYLRPCGVEYSLLCSIIIVVIWNDICTVPGSKPLNDVNSN-GIYTKDVKQCCTRIKSNNHFSVDCGSAHKGLFMGIAVLAGTIVSLMLFNGLFQKDKHEELALLQINIWETVLFVIMTIGSGACIQRMRLLTLRKISTTMPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEA----RIIAPLCAIIQSSCQSLLVLDAWSRRCAGT--GGRPGRQLVTFLLVGNFALWLLNRVKNARAEYHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTKNDA-SIRDDNEFELK 611          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|930648895|gb|KPI91243.1| (hypothetical protein RR46_14747 [Papilio xuthus])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 390/593 (65.77%), Postives = 440/593 (74.20%), Query Frame = 0
Query:   52 EHPHPPHSLPRLSVVPPASNSSSTDNIAAPAP-KPKRPLSHGDESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNET-TMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            E   PPH+LPRLSVV P S++SS +    PAP KP+ PLSHGDESMTVVLSAFYAKLLIVLG+ALPVTSTIQNEL TN+TSDIFT+YLYI+SM FLAYTFYHL   KK  K  NVKRTRYGSFYLH+GVAGFSVGSIIYSCLQ   YFDLSGDCQ+++VA+KP LRIL+MVAQ+VFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNV+IQETRDDI+AVAY+ P  +RY  I+ P ++       N  + E  +  NI+ N T     W+C++S++ITPLIRS NPYLRPCGVEYSLLCSIII VIWNDICTVPGSK     NS+   F  + ++CCAR+KSNNHFSVDCGSAHKGLFMG+AVLAGTIVSLMLFNGLFQ  KHV                                           E ALL   Q  ++   LF I+  G                    +++QSSCQ+LLVLDAWSRRCAG   G RPGRQLVTFLLVGNFALWLLNRVKNARAE+HPLQMEF+GVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKT  D+  +  ++EFELK
Sbjct:   32 ESELPPHTLPRLSVVLPCSSTSSIE----PAPNKPRSPLSHGDESMTVVLSAFYAKLLIVLGLALPVTSTIQNELVTNVTSDIFTIYLYIVSMLFLAYTFYHLSRVKKS-KDVNVKRTRYGSFYLHIGVAGFSVGSIIYSCLQIAEYFDLSGDCQIIMVALKPTLRILFMVAQSVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVIIQETRDDIIAVAYNSPPFIRYTAIAEPTKSPFATRDKNYLY-EDYNSTNISENTTMAAATWSCNISNIITPLIRSANPYLRPCGVEYSLLCSIIIVVIWNDICTVPGSKPLNDVNSN-AVFTKDVKQCCARVKSNNHFSVDCGSAHKGLFMGIAVLAGTIVSLMLFNGLFQKDKHV-------------------------------------------ELALL---QINIWETVLFVIMTIG--------------------SVIQSSCQSLLVLDAWSRRCAGT--GGRPGRQLVTFLLVGNFALWLLNRVKNARAEYHPLQMEFFGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTKSDT-SIRDDNEFELK 548          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|914565467|gb|KOB70476.1| (Otopetrin-2, partial [Operophtera brumata])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 354/467 (75.80%), Postives = 387/467 (82.87%), Query Frame = 0
Query:  177 MGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIE----HLSL-------ANITSNETTMRN----WTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNK 628
            MGVAGF VGSIIYSCLQFGGYFDL+GDCQL +VA+KPA RI++MVAQT+FIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVV+QETRDDI+ VAYDRP LLRYANISG ++  IMD++DN TF E    H +L        N+T N   +      WTC+VSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSK  +K    PQ     S++CCAR+KSNNHFSVDCGSAHKGLFMG+ VLAGTIVSLMLFNGLFQN+KHV+LALLQ+N+WET+LF++MT GSGACIQRMRTLP RR+V  LPLEH+LLLVTQCGVYLYYLFQIIGAGFLIQRYPEG RATR+             TLLV DAW+RRCAG  G +RPGRQLVTFLLVGNFALWLLNR            MEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYK NK
Sbjct:    1 MGVAGFGVGSIIYSCLQFGGYFDLTGDCQLAVVAIKPAFRIVFMVAQTIFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVVQETRDDILTVAYDRPTLLRYANISGHSKIDIMDQLDNVTFEEVAKPHTTLNISNDIFLNVTLNSLNLSVNNDIWTCNVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKPAQK----PQLSKESSKQCCARMKSNNHFSVDCGSAHKGLFMGIVVLAGTIVSLMLFNGLFQNEKHVDLALLQINIWETVLFIVMTVGSGACIQRMRTLPLRRSVTTLPLEHSLLLVTQCGVYLYYLFQIIGAGFLIQRYPEGMRATRL-------------TLLVFDAWTRRCAGN-GRQRPGRQLVTFLLVGNFALWLLNR------------MEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKRNK 437          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|357607269|gb|EHJ65424.1| (hypothetical protein KGM_05456 [Danaus plexippus])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 276/394 (70.05%), Postives = 318/394 (80.71%), Query Frame = 0
Query:  248 MHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDNATFIEHLSLANITSNETTMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQIIGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFEL 641
            MHLIATNVCEWLNVVIQETRDDI AVA+  PAL+RY +I G ++T   + ++  +   +L+   + +    +  W+C+VSD+I+PLIR++NPYLRPCGVEYSLLCSIII VIWND+CTVPGSK    SNS      +E +   AR+K  NHFSVDCG AHKGLF+GVAVLA TIVSLM+F GLFQ +KHVELALL +NVWETILFVLM+ GS AC+Q M TL + +    LPLEHALLLVTQCGVYLYYLFQIIGAGF IQ++P  RRATRI+SPLCA++QSSCQTLLVLDAWSRR AG     RPGRQLVTFLLV NF+LW+LNRVKNARAEFHPLQMEFYGVWAWT+ITHVSVPLLVCYRFQATVCFYEIWKNSYK  K+    +  DE EL
Sbjct:    1 MHLIATNVCEWLNVVIQETRDDIRAVAFHEPALVRYTDIEGLSKTTFTETINGTSPANYLNRTEVIATGHGLEAWSCNVSDVISPLIRNMNPYLRPCGVEYSLLCSIIIVVIWNDVCTVPGSK-PIASNSK-----LEKKPRSARVKPMNHFSVDCGQAHKGLFLGVAVLAATIVSLMIFKGLFQKEKHVELALLTINVWETILFVLMSVGSAACLQCMSTLSSLKRYPGLPLEHALLLVTQCGVYLYYLFQIIGAGFSIQKFPSARRATRIISPLCAVIQSSCQTLLVLDAWSRRSAGRED--RPGRQLVTFLLVSNFSLWMLNRVKNARAEFHPLQMEFYGVWAWTIITHVSVPLLVCYRFQATVCFYEIWKNSYKRKKEYDSEL--DEIEL 384          
BLAST of HiSeq13365 vs. genbank:protein
Match: gi|768412630|ref|XP_011568401.1| (PREDICTED: uncharacterized protein LOC105398046 [Plutella xylostella])

HSP 1 Score: 524.628 bits (1350), Expect = 1.562e-174
Identity = 273/413 (66.10%), Postives = 321/413 (77.72%), Query Frame = 0
Query:   94 ESMTVVLSAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTFYHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDLSGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHLIATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIM------DEVDNATFIEHLSLANITSNETTMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSLLCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVE-LALLQVNVWETILFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQ 499
            ESMTV+LSAFYAKLLIVLG+ALPVTSTIQNELYTN++SDIFTMYLYI+SM FLAYTFYHLRI+ K  K  N+KRTRYGSFYLHMGVAGFSVGSIIYSCLQ GGYFDL GDC+LL+VA+KPALRIL+ VAQTVFIFSYTDILDPMRG+VL RFGLMHLIATNVCEWLNVV+QETRDDI+ VAYDRPA+ RYANI+GP +          D   NAT      LAN++++ET    W+C+V+DMI PLIRS NPYLRPCGVEYSLLCS+IIAVIWNDICTVPG+K   KS  +  T      +  ++ K++NH+SVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLF N+K +  L  +  + ++T+L  ++ A S  C    R  P R+ V  L + +  L +   G +  +L  
Sbjct:  287 ESMTVLLSAFYAKLLIVLGIALPVTSTIQNELYTNLSSDIFTMYLYIVSMTFLAYTFYHLRISSKP-KNQNLKRTRYGSFYLHMGVAGFSVGSIIYSCLQVGGYFDLRGDCRLLVVALKPALRILFTVAQTVFIFSYTDILDPMRGIVLHRFGLMHLIATNVCEWLNVVVQETRDDIITVAYDRPAMQRYANITGPPKITYETNYTQDDLSQNATQNITDLLANLSASET----WSCNVTDMIAPLIRSANPYLRPCGVEYSLLCSVIIAVIWNDICTVPGTK-AYKSQLAANTMLETQNKSYSKFKASNHYSVDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFHNKKIISPLCAVVQSSFQTLL--VLDAWSRRCGGASR--PGRQLVTFLLVGNFALWLLNMGNFALWLLN 689          

HSP 2 Score: 214.927 bits (546), Expect = 1.149e-56
Identity = 104/135 (77.04%), Postives = 113/135 (83.70%), Query Frame = 0
Query:  518 RILSPLCALVQSSCQTLLVLDAWSRRCAGAPGGRRPGRQLVTFLLVGNFALWLLN----------RVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELK 642
            +I+SPLCA+VQSS QTLLVLDAWSRRC GA    RPGRQLVTFLLVGNFALWLLN          RVKN+RAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYK +KD+ + +  D+ ELK
Sbjct:  628 KIISPLCAVVQSSFQTLLVLDAWSRRCGGAS---RPGRQLVTFLLVGNFALWLLNMGNFALWLLNRVKNSRAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSYKQSKDTRNELDFDDIELK 759          

HSP 3 Score: 123.25 bits (308), Expect = 1.320e-25
Identity = 51/98 (52.04%), Postives = 71/98 (72.45%), Query Frame = 0
Query:  528 QSSCQTLLVLDAWSRRCAGAPGGR-RPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHVSVPLLVCYRFQATVCFYEIWKNSY 624
            Q+  Q+L ++D W RR   +   R +PGRQLVTF+LV N A+W +N ++  RAEF P  + FYG WAWT+ITHVS+PL + YRF +T+C +EIWKN++
Sbjct:  184 QTIVQSLFIIDGWWRRSVTSEQRRSKPGRQLVTFMLVANMAMWAINTLEKNRAEFRPAHLAFYGPWAWTIITHVSMPLAIFYRFHSTICLFEIWKNAF 281          
The following BLAST results are available for this feature:
BLAST of HiSeq13365 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913309792|ref|XP_013185498.1|0.000e+077.10PREDICTED: uncharacterized protein LOC106131056 [A... [more]
gi|827550941|ref|XP_012547392.1|0.000e+074.02PREDICTED: uncharacterized protein LOC101735423 [B... [more]
gi|910342618|ref|XP_013175045.1|0.000e+076.39PREDICTED: uncharacterized protein LOC106123335 [P... [more]
gi|943944988|ref|XP_014355788.1|0.000e+076.18PREDICTED: uncharacterized protein LOC106708752 [P... [more]
gi|909559181|ref|XP_013134634.1|0.000e+076.31PREDICTED: uncharacterized protein LOC106100353 [P... [more]
gi|930676735|gb|KPJ16873.1|0.000e+075.51Otopetrin-2 [Papilio machaon][more]
gi|930648895|gb|KPI91243.1|0.000e+065.77hypothetical protein RR46_14747 [Papilio xuthus][more]
gi|914565467|gb|KOB70476.1|0.000e+075.80Otopetrin-2, partial [Operophtera brumata][more]
gi|357607269|gb|EHJ65424.1|0.000e+070.05hypothetical protein KGM_05456 [Danaus plexippus][more]
gi|768412630|ref|XP_011568401.1|1.562e-17466.10PREDICTED: uncharacterized protein LOC105398046 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 174..610
e-value: 3.0E-92
score: 309.8
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 81..629
NoneNo IPR availablePANTHERPTHR21522:SF41SUBFAMILY NOT NAMEDcoord: 81..629
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 508..518
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 542..552
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 217..234
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 410..432
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..95
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 553..571
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 572..590
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 173..197
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 433..443
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 444..463
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 235..409
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 464..483
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 96..116
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 611..642
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 136..153
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 154..172
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 198..216
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 484..507
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 591..610
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 519..541
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 117..135
NoneNo IPR availableTMHMMTMhelixcoord: 589..608
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 557..574
NoneNo IPR availableTMHMMTMhelixcoord: 133..155
NoneNo IPR availableTMHMMTMhelixcoord: 444..463
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 485..507

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13365HiSeq13365Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13365_p ID=HiSeq13365_p|Name=HiSeq13365|organism=Ostrinia scapulalis|type=polypeptide|length=643bp
MEDVIEEEVEWHGEQRSRHPANTEHYEHGLHHYHPHRQTSTSLERKIRHN
REHPHPPHSLPRLSVVPPASNSSSTDNIAAPAPKPKRPLSHGDESMTVVL
SAFYAKLLIVLGVALPVTSTIQNELYTNITSDIFTMYLYIISMAFLAYTF
YHLRIAKKDLKKDNVKRTRYGSFYLHMGVAGFSVGSIIYSCLQFGGYFDL
SGDCQLLIVAVKPALRILYMVAQTVFIFSYTDILDPMRGVVLDRFGLMHL
IATNVCEWLNVVIQETRDDIVAVAYDRPALLRYANISGPAQTIIMDEVDN
ATFIEHLSLANITSNETTMRNWTCDVSDMITPLIRSVNPYLRPCGVEYSL
LCSIIIAVIWNDICTVPGSKFTKKSNSSPQTFGIESRRCCARIKSNNHFS
VDCGSAHKGLFMGVAVLAGTIVSLMLFNGLFQNQKHVELALLQVNVWETI
LFVLMTAGSGACIQRMRTLPARRAVAALPLEHALLLVTQCGVYLYYLFQI
IGAGFLIQRYPEGRRATRILSPLCALVQSSCQTLLVLDAWSRRCAGAPGG
RRPGRQLVTFLLVGNFALWLLNRVKNARAEFHPLQMEFYGVWAWTLITHV
SVPLLVCYRFQATVCFYEIWKNSYKTNKDSIDVIAEDEFELKN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin