HiSeq13533_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13533
Unique NameHiSeq13533_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length183
Homology
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|357631261|gb|EHJ78851.1| (frizzled-2 [Danaus plexippus])

HSP 1 Score: 291.967 bits (746), Expect = 1.558e-92
Identity = 146/187 (78.07%), Postives = 159/187 (85.03%), Query Frame = 0
Query:    1 MWVWALLVVAVAGARAAQPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR-EPEPEPPKPPRRPHARCKDPKNCPSGAGTAAADAA---CACACRPP 183
            MW    LV+ +AGA A QPRCEEITIPMCRGIGYN+TSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM+KYGFQWPERMACE+LP++GD+EHLCMEEPDR +    P  PPRRP+  CKDPKNC SG   +  +A    CACACRPP
Sbjct:  131 MWRVVSLVLVLAGAEALQPRCEEITIPMCRGIGYNLTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQKYGFQWPERMACEKLPRLGDSEHLCMEEPDRAQEPEPPRPPPRRPYKNCKDPKNCESGPAASPGEAGGDECACACRPP 317          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|913315070|ref|XP_013188397.1| (PREDICTED: frizzled-2 [Amyelois transitella])

HSP 1 Score: 255.373 bits (651), Expect = 1.397e-79
Identity = 132/172 (76.74%), Postives = 145/172 (84.30%), Query Frame = 0
Query:   18 QPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPD--REPEPEPPKPPRRPHARCKDPKNCPSGAGTAAADAA----CACACRPP 183
            QPRCEEI IPMCRGIGYN+TSFPNALDHDTQ+EAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM++YGF+WPERMACE+LP+MGD +HLCM+E D   EPEP  P P +  +  CKDPKNC SG   +A   A    CACACRPP
Sbjct:   23 QPRCEEIVIPMCRGIGYNLTSFPNALDHDTQEEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQQYGFKWPERMACEKLPRMGDPDHLCMDENDREPEPEPTRPPPRKTFNKHCKDPKNCESGPAASAGAGAGGTECACACRPP 194          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|943974612|ref|XP_014368584.1| (PREDICTED: frizzled-2-like [Papilio machaon])

HSP 1 Score: 246.899 bits (629), Expect = 3.000e-78
Identity = 123/149 (82.55%), Postives = 133/149 (89.26%), Query Frame = 0
Query:   18 QPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR-EPEPEPPKPPRRPHARCKDPKNCPS 165
            QPRCEEITIPMCRGIGYN+TSFPNALDHDTQ+EAGLEVHQYWPLVEIKCS DLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM+KYGFQWPERMACE+LPKMG+ + LCM+E +R +    P  PPRRPH  CKDPKNC S
Sbjct:   29 QPRCEEITIPMCRGIGYNLTSFPNALDHDTQEEAGLEVHQYWPLVEIKCSPDLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQKYGFQWPERMACEKLPKMGEPDQLCMDENERAQEPEPPRPPPRRPHKPCKDPKNCES 177          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|930660189|gb|KPJ02184.1| (Frizzled-2 [Papilio xuthus])

HSP 1 Score: 248.44 bits (633), Expect = 4.667e-78
Identity = 123/149 (82.55%), Postives = 133/149 (89.26%), Query Frame = 0
Query:   18 QPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR-EPEPEPPKPPRRPHARCKDPKNCPS 165
            QPRCEEITIPMCRGIGYN+TSFPNALDHDTQ+EAGLEVHQYWPLVEIKCS DLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM+KYGFQWPERMACE+LPKMG+ + LCM+E +R +    P  PPRRPH  CKDPKNC S
Sbjct:   56 QPRCEEITIPMCRGIGYNLTSFPNALDHDTQEEAGLEVHQYWPLVEIKCSPDLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQKYGFQWPERMACEKLPKMGEPDQLCMDENERAQEPEPPRPPPRRPHKPCKDPKNCES 204          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|910337711|ref|XP_013172432.1| (PREDICTED: frizzled-2 [Papilio xuthus])

HSP 1 Score: 249.21 bits (635), Expect = 3.485e-77
Identity = 123/149 (82.55%), Postives = 133/149 (89.26%), Query Frame = 0
Query:   18 QPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR-EPEPEPPKPPRRPHARCKDPKNCPS 165
            QPRCEEITIPMCRGIGYN+TSFPNALDHDTQ+EAGLEVHQYWPLVEIKCS DLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM+KYGFQWPERMACE+LPKMG+ + LCM+E +R +    P  PPRRPH  CKDPKNC S
Sbjct:   29 QPRCEEITIPMCRGIGYNLTSFPNALDHDTQEEAGLEVHQYWPLVEIKCSPDLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQKYGFQWPERMACEKLPKMGEPDQLCMDENERAQEPEPPRPPPRRPHKPCKDPKNCES 177          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|930666313|gb|KPJ07431.1| (Frizzled-2 [Papilio machaon])

HSP 1 Score: 246.514 bits (628), Expect = 1.102e-76
Identity = 123/149 (82.55%), Postives = 133/149 (89.26%), Query Frame = 0
Query:   18 QPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR-EPEPEPPKPPRRPHARCKDPKNCPS 165
            QPRCEEITIPMCRGIGYN+TSFPNALDHDTQ+EAGLEVHQYWPLVEIKCS DLKFFLCSVYTPICIE+Y KPLPACRSVCERAR GCAPLM+KYGFQWPERMACE+LPKMG+ + LCM+E +R +    P  PPRRPH  CKDPKNC S
Sbjct:   29 QPRCEEITIPMCRGIGYNLTSFPNALDHDTQEEAGLEVHQYWPLVEIKCSPDLKFFLCSVYTPICIEDYAKPLPACRSVCERARAGCAPLMQKYGFQWPERMACEKLPKMGEPDQLCMDENERAQEPEPPRPPPRRPHKPCKDPKNCES 177          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|345496907|ref|XP_003427847.1| (PREDICTED: frizzled-2-like [Nasonia vitripennis])

HSP 1 Score: 242.276 bits (617), Expect = 3.329e-73
Identity = 113/176 (64.20%), Postives = 129/176 (73.30%), Query Frame = 0
Query:   20 RCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDRE-----------PEPEPPKPPRRPHA-RCKDPKNCPSGAGTAAADAACACACRPP 183
            RCEEITIPMC+GIGYN+T+ PN L+HDTQDEAGLEVHQ+WPLVEIKCS DLKFFLCS+YTPIC+ EY KPLPACRSVCERAR GCAPLM +YGF WPERMACERLP  GD E+LCME+ +R              P+P K P+   A +CK  KN       +  +  C C CRPP
Sbjct:   85 RCEEITIPMCKGIGYNLTTMPNELNHDTQDEAGLEVHQFWPLVEIKCSLDLKFFLCSMYTPICLPEYSKPLPACRSVCERARMGCAPLMHQYGFSWPERMACERLPNQGDPENLCMEQDNRTTLVSTEILTPIALPKPTKTPKGFQATKCKPGKN-QKNCHHSIEEKDCTCRCRPP 259          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|1058009582|gb|JAS08475.1| (hypothetical protein g.38421 [Clastoptera arizonana] >gi|1058026869|gb|JAS17096.1| hypothetical protein g.38425 [Clastoptera arizonana])

HSP 1 Score: 238.424 bits (607), Expect = 2.585e-72
Identity = 115/186 (61.83%), Postives = 138/186 (74.19%), Query Frame = 0
Query:    6 LLVVAVAGARAAQPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDR----EPEPEPPKP----PRRPHARCKDPKNCPSGAGTAAADAACACACRPP 183
            ++V + +G+ A   RCEEITIP+CRGIGYN+TS PN L+HDTQ+EAGLEVHQ+WPLVEI CS DLKFFLCS+Y PICIE+Y KPLPACRSVCERAR+GC+PLM +YGFQWPERM CE+LP +GD ++LCME+ +R     P    PKP    P RP   CK  KNC         +  C+C CRPP
Sbjct:   25 VVVASASGSAAQNARCEEITIPICRGIGYNLTSMPNELNHDTQEEAGLEVHQFWPLVEINCSRDLKFFLCSMYAPICIEDYMKPLPACRSVCERARDGCSPLMLQYGFQWPERMTCEKLPVLGDPDNLCMEQNNRSDMQHPTVTSPKPAKKQPARPAPGCKG-KNCRDSNHGLPDNKDCSCRCRPP 209          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|936586568|ref|XP_014206872.1| (PREDICTED: frizzled-5-like [Copidosoma floridanum] >gi|936586571|ref|XP_014206873.1| PREDICTED: frizzled-5-like [Copidosoma floridanum] >gi|936586574|ref|XP_014206874.1| PREDICTED: frizzled-5-like [Copidosoma floridanum] >gi|936586577|ref|XP_014206875.1| PREDICTED: frizzled-5-like [Copidosoma floridanum] >gi|936586580|ref|XP_014206877.1| PREDICTED: frizzled-5-like [Copidosoma floridanum] >gi|936586583|ref|XP_014206878.1| PREDICTED: frizzled-5-like [Copidosoma floridanum])

HSP 1 Score: 236.498 bits (602), Expect = 4.557e-71
Identity = 111/182 (60.99%), Postives = 131/182 (71.98%), Query Frame = 0
Query:   20 RCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDRE-------PEPEPP----KPPRRPHA----RC---KDPKNCPSGAGTAAADAACACACRPP 183
            RCEEITIPMCRGIGYN T+ PN L+HDTQ+EAGLEVHQ+WPLVEIKCS+DLKFFLCS+YTPIC+ EY KPLPAC+SVCERAR GCAPLM++YGF WPERMACERLP  GD+++LCME+ ++         +  PP    KP +        +C   K+ KNC         D  C C CRPP
Sbjct:   80 RCEEITIPMCRGIGYNFTAMPNELNHDTQEEAGLEVHQFWPLVEIKCSSDLKFFLCSMYTPICLPEYTKPLPACKSVCERARTGCAPLMQQYGFSWPERMACERLPSQGDSDNLCMEQDNKTLLSTDVIAQSIPPVLLSKPTKSSKTIQSVKCKPGKNQKNCLYSNNNKEKD--CTCRCRPP 259          
BLAST of HiSeq13533 vs. genbank:protein
Match: gi|732590883|gb|JAG10865.1| (Frizzled-2 [Lygus hesperus] >gi|1006101128|gb|JAQ04738.1| Frizzled-2 [Lygus hesperus])

HSP 1 Score: 233.032 bits (593), Expect = 9.615e-71
Identity = 115/173 (66.47%), Postives = 133/173 (76.88%), Query Frame = 0
Query:   11 VAGARAAQPRCEEITIPMCRGIGYNMTSFPNALDHDTQDEAGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERAREGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDREPEPEPPKPPRRPHARCKDPKNCPSGAGTAAADAACACACRPP 183
            V       PRCEEITIPMCRGIGYN+TS PN L+HDTQ+EAGLEVHQ+WPLVEIKCS DLKFFLCS+Y PICIE+Y +PLPACRSVCERAR GCAPLM++YGFQWPERM+CE+LP  GD E+LCME  +R  E +P K P  P ++CK  + CP        D  C+C CRPP
Sbjct:   22 VLVTSGGGPRCEEITIPMCRGIGYNLTSMPNELNHDTQEEAGLEVHQFWPLVEIKCSPDLKFFLCSMYAPICIEDYHQPLPACRSVCERARSGCAPLMQQYGFQWPERMSCEKLPVHGDPENLCMEMDNRT-EAKPTKRP-APTSKCKG-RKCP--------DRDCSCKCRPP 183          
The following BLAST results are available for this feature:
BLAST of HiSeq13533 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357631261|gb|EHJ78851.1|1.558e-9278.07frizzled-2 [Danaus plexippus][more]
gi|913315070|ref|XP_013188397.1|1.397e-7976.74PREDICTED: frizzled-2 [Amyelois transitella][more]
gi|943974612|ref|XP_014368584.1|3.000e-7882.55PREDICTED: frizzled-2-like [Papilio machaon][more]
gi|930660189|gb|KPJ02184.1|4.667e-7882.55Frizzled-2 [Papilio xuthus][more]
gi|910337711|ref|XP_013172432.1|3.485e-7782.55PREDICTED: frizzled-2 [Papilio xuthus][more]
gi|930666313|gb|KPJ07431.1|1.102e-7682.55Frizzled-2 [Papilio machaon][more]
gi|345496907|ref|XP_003427847.1|3.329e-7364.20PREDICTED: frizzled-2-like [Nasonia vitripennis][more]
gi|1058009582|gb|JAS08475.1|2.585e-7261.83hypothetical protein g.38421 [Clastoptera arizonan... [more]
gi|936586568|ref|XP_014206872.1|4.557e-7160.99PREDICTED: frizzled-5-like [Copidosoma floridanum]... [more]
gi|732590883|gb|JAG10865.1|9.615e-7166.47Frizzled-2 [Lygus hesperus] >gi|1006101128|gb|JAQ0... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007275 multicellular organism development
biological_process GO:0016055 Wnt signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005515 protein binding
molecular_function GO:0004888 transmembrane signaling receptor activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020067Frizzled domainSMARTSM00063FRIcoord: 20..139
e-value: 1.3E-69
score: 247.2
IPR020067Frizzled domainGENE3D1.10.2000.10coord: 17..138
e-value: 1.1E-45
score: 154.5
IPR020067Frizzled domainPFAMPF01392Fzcoord: 21..135
e-value: 3.1E-36
score: 124.1
IPR020067Frizzled domainPROSITEPS50038FZcoord: 16..137
score: 29.411
IPR020067Frizzled domainSUPERFAMILY63501Frizzled cysteine-rich domaincoord: 20..137
NoneNo IPR availablePANTHERPTHR11309:SF82FRIZZLED-2coord: 18..181
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..16
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 12..16
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 3..11
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..2
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 17..183
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.906
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 18..181

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13533HiSeq13533Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13533_p ID=HiSeq13533_p|Name=HiSeq13533|organism=Ostrinia scapulalis|type=polypeptide|length=183bp
MWVWALLVVAVAGARAAQPRCEEITIPMCRGIGYNMTSFPNALDHDTQDE
AGLEVHQYWPLVEIKCSADLKFFLCSVYTPICIEEYEKPLPACRSVCERA
REGCAPLMRKYGFQWPERMACERLPKMGDAEHLCMEEPDREPEPEPPKPP
RRPHARCKDPKNCPSGAGTAAADAACACACRPP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR015526Frizzled/SFRP
IPR020067Frizzled_dom