HiSeq13535_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13535
Unique NameHiSeq13535_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length244
Homology
BLAST of HiSeq13535 vs. genbank:protein
Match: gi|913328427|ref|XP_013195724.1| (PREDICTED: uncharacterized protein LOC106138960 [Amyelois transitella])

HSP 1 Score: 118.627 bits (296), Expect = 1.076e-27
Identity = 86/250 (34.40%), Postives = 124/250 (49.60%), Query Frame = 0
Query:    2 KMSHAASETDTKKGSE--------------IYKKP--YERSKSSAVWEHFTIKDNVKKIATCKVCDHTLSYLSTTSNLKKHWSNKHCVQKERVTRV----------VDDDETDCEN-SGTVTENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHHGKKRKLSSEAQGKNSETETRKRIHT--GKRNSIAWKYFTIKDHASKIATCTLCGKSMSYSNVSNLMKHVKNVH 222
            KM+    E+D +K  E              + +KP    R+  S  W++F +KD  +KIATCK+C + LSY S  SNL KH   +H +     T+           +DD+E++ E     + E  ++ RR   S+AWK+F V+D    IA C  C + +SY SSVSNL KH+  KH            G ++ T+ + R HT  G   S  W +    DH  KIA C +C K +SY  ++NL +HV N H
Sbjct:    2 KMASTGGESDKEKSKEFNDEESNNEEYVEYLDEKPNFQRRANVSLAWKYFDLKDQEQKIATCKICANELSYRSV-SNLTKHVRRRHGLGLSTSTQEQANSDTENIKLDDEESNSEEFVEYLEEKPEESRRPNVSLAWKYFEVKDRELRIATCNICARELSY-SSVSNLTKHVRRKH----------GLGLSTSTQDQPRNHTREGMTRSSIWHFCKKIDHMKKIAMCLVCKKKLSYKTINNLRRHVLNQH 239          
BLAST of HiSeq13535 vs. genbank:protein
Match: gi|1073539349|gb|JAT86786.1| (hypothetical protein g.2585 [Pectinophora gossypiella])

HSP 1 Score: 107.071 bits (266), Expect = 2.363e-23
Identity = 70/203 (34.48%), Postives = 108/203 (53.20%), Query Frame = 0
Query:   29 SAVWEHFTIKDNVKKIATCKVCDHTLSYLSTTSNLKKHWSNKHCVQKERVTRVVDDDETDCENSGTVTENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHHGKKRKLSSEAQGKNSETETRKRIHTGKR--NSIAWKYFTIKDHASKIATCTLCGKSMSYS-NVSNLMKHVKNVHRKHNNI 228
            S +WE+F  KD  +K+A+C++C    SY ++ S L  H  +KH +   + +   D   TD E+      +   GR  K+S AW++F ++D  R +A+C  C    SY +SVSNLMKH   KH+ + R    E    +   E  K   +  R   SI W YF   D  +K++ C +C K +S+S  ++NL KH++   RKH N+
Sbjct:   40 SEIWEYFDTKDEDEKVASCRLCLDQFSYKTSLSKLSSHLKSKHSIDFGKGSDDEDYKGTDDEDVSLAHLSESRGRG-KSSEAWEYFEIKDDERKVARCNLCGALCSYRTSVSNLMKHARRKHNMRPRTSDCEEDPGDDHHEDSKVDTSVSRAQRSIVWLYFKCVDPDAKLSQCMICKKLLSHSTTLTNLKKHLE---RKHPNV 238          

HSP 2 Score: 86.6557 bits (213), Expect = 4.854e-16
Identity = 59/180 (32.78%), Postives = 88/180 (48.89%), Query Frame = 0
Query:   65 KHWSNKHCVQKERVTRVVDDDETDCENSGTVTENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHHGKKRKLSSEAQGKNSETETRKRIHTGK-----RNSIAWKYFTIKDHASKIATCTLCGKSMSY-SNVSNLMKHVKNVHRKHNNISDCRKNDNDD 238
            KH   KH   +  +    D  E D EN     E+ ++ ++   S  W++F  +D    +A C+ C    SY +S+S L  H+ +KH     K S +   K ++ E     H  +     ++S AW+YF IKD   K+A C LCG   SY ++VSNLMKH +  H      SDC ++  DD
Sbjct:    2 KHLRGKHGYTRSELKGDEDGTEGDTEN-----EDKEETKQNIKSEIWEYFDTKDEDEKVASCRLCLDQFSYKTSLSKLSSHLKSKHSIDFGKGSDDEDYKGTDDEDVSLAHLSESRGRGKSSEAWEYFEIKDDERKVARCNLCGALCSYRTSVSNLMKHARRKHNMRPRTSDCEEDPGDD 176          

HSP 3 Score: 75.0998 bits (183), Expect = 4.645e-12
Identity = 52/159 (32.70%), Postives = 81/159 (50.94%), Query Frame = 0
Query:   25 RSKSSAVWEHFTIKDNVKKIATCKVCDHTLSYLSTTSNLKKHWSNKHCVQKERVTRVVDDDETDCENSGTVTENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHH---------GKKRKLSSEAQGKNSETETRKRI 174
            R KSS  WE+F IKD+ +K+A C +C    SY ++ SNL KH   KH + + R +   +D   D      V  +V   +R   SI W +F   D    +++C  C K +S+ ++++NL KH++ KH          G+KR L S   G+  E E   ++
Sbjct:  114 RGKSSEAWEYFEIKDDERKVARCNLCGALCSYRTSVSNLMKHARRKHNM-RPRTSDCEEDPGDDHHEDSKVDTSVSRAQR---SIVWLYFKCVDPDAKLSQCMICKKLLSHSTTLTNLKKHLERKHPNVKIPVREDGRKRILLSSG-GELYEVEAGTKL 267          
BLAST of HiSeq13535 vs. genbank:protein
Match: gi|668457909|gb|KFB45883.1| (Dmoj\GI10409-PA-like protein [Anopheles sinensis])

HSP 1 Score: 76.6406 bits (187), Expect = 1.357e-12
Identity = 68/235 (28.94%), Postives = 109/235 (46.38%), Query Frame = 0
Query:   27 KSSAVWEHFTIKDNVKKIATCKVCDHTLSYLSTTSNLKKHWSNKHCVQKERVTRVVDDDETDCENSGTV-----------------TENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHHG---KKRKLSSEAQGKNSETETRKRIHTGKRNSIAWKYFTIKDHASKIATCTLCGKSMSYSN--VSNLMKHVKNVHRKHNN--ISDCRKNDND 237
            ++S+VWEHFT+  +  K A C  C+  L+Y  TT NLK+H+ NKH         ++DD+E + E +G +                  E+ K G  R ++I W HF        + KC  C+  ++   + SN+ +H+   H G     R       G   +T       T  + S+ WK+F+ +D A   A C  CG  +++S   +SNL +H   + RKH     +D  +ND +
Sbjct:   19 RTSSVWEHFTVLSD--KRAQCHACNKVLAYNRTTFNLKRHFLNKHPDIPMAADDILDDEEAN-EFAGIIKGEDQVFEEEFEQERPPDESAKRGPYRSSAI-WSHFKKLSG--NLKKCLHCNLVIAS-QNTSNMRRHVARIHPGVDLGPRIKRVSLMGSTPKT-------TKPKKSMLWKHFS-RDVARNKAECLHCGDRLTFSGCEISNLRRH---LFRKHPGEVYNDTPENDGN 235          
BLAST of HiSeq13535 vs. genbank:protein
Match: gi|909566186|ref|XP_013138447.1| (PREDICTED: zinc finger BED domain-containing protein 6 isoform X1 [Papilio polytes] >gi|909566188|ref|XP_013138448.1| PREDICTED: zinc finger BED domain-containing protein 6 isoform X1 [Papilio polytes] >gi|909566190|ref|XP_013138450.1| PREDICTED: zinc finger BED domain-containing protein 6 isoform X1 [Papilio polytes])

HSP 1 Score: 72.4034 bits (176), Expect = 6.794e-11
Identity = 74/232 (31.90%), Postives = 102/232 (43.97%), Query Frame = 0
Query:   31 VWEHFTIKDNVKKIATCKVCDHTLSYLSTTSNLKKHWSNKHC---VQKE---RVTRVVDDDETDCENSGTVTENVKDGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKHHGKKRKLSSE---------------AQGKNSETETRKRIHTGKRNSIAWKYFTIKDHASKIATCTLCGKSMSY-SNVSNLMKHVKNVHRKHNNISDCRKNDNDDSE 240
            +W HF    N K  A CK+C+  +SY ++ SNL  H   KHC   V  E       V  DD+        V E  K  RR   S AW HF   D     A+CK C   +SY +S++NL KH++  H   K  L SE               ++  NS  E  ++  +G++ S AW +F   D  +  A C  C   MSY   ++NL  H    H   + +S C   D+ D E
Sbjct:    8 LWSHFDDTGNHK--ARCKICESIISYKTSVSNLAMHMLEKHCSREVSPECSGSFAFVEVDDKPANYEDDRVAE--KKNRRSYRSKAWNHF--DDIGDKKARCKYCQIVMSYRTSITNLTKHVNRAHF--KNVLPSEVDSSDVETTVVTVEESENDNSHVEEEQK--SGRKFSKAWCHF--DDLGNYKAQCKYCKIVMSYKGTITNLKTHFIRAHL--DELSVCDPVDSSDLE 225          
The following BLAST results are available for this feature:
BLAST of HiSeq13535 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 4
Match NameE-valueIdentityDescription
gi|913328427|ref|XP_013195724.1|1.076e-2734.40PREDICTED: uncharacterized protein LOC106138960 [A... [more]
gi|1073539349|gb|JAT86786.1|2.363e-2334.48hypothetical protein g.2585 [Pectinophora gossypie... [more]
gi|668457909|gb|KFB45883.1|1.357e-1228.94Dmoj\GI10409-PA-like protein [Anopheles sinensis][more]
gi|909566186|ref|XP_013138447.1|6.794e-1131.90PREDICTED: zinc finger BED domain-containing prote... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003677 DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 197..222
e-value: 1.0
score: 18.4
coord: 124..150
e-value: 8.4
score: 13.9
coord: 45..71
e-value: 54.0
score: 6.8
IPR003656Zinc finger, BED-typeSMARTSM00614ZnF_BEDcoord: 26..74
e-value: 2.6E-5
score: 33.6
coord: 178..225
e-value: 3.1E-5
score: 33.4
coord: 105..153
e-value: 2.7E-7
score: 40.2
IPR003656Zinc finger, BED-typePFAMPF02892zf-BEDcoord: 108..150
e-value: 2.8E-7
score: 30.0
coord: 181..223
e-value: 2.3E-9
score: 36.7
coord: 29..71
e-value: 8.6E-9
score: 34.9
IPR003656Zinc finger, BED-typePROSITEPS50808ZF_BEDcoord: 178..229
score: 10.085
IPR003656Zinc finger, BED-typePROSITEPS50808ZF_BEDcoord: 105..157
score: 10.915
IPR003656Zinc finger, BED-typePROSITEPS50808ZF_BEDcoord: 26..78
score: 10.42
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 181..225
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 108..156
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 29..77

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13535HiSeq13535Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13535_p ID=HiSeq13535_p|Name=HiSeq13535|organism=Ostrinia scapulalis|type=polypeptide|length=244bp
RKMSHAASETDTKKGSEIYKKPYERSKSSAVWEHFTIKDNVKKIATCKVC
DHTLSYLSTTSNLKKHWSNKHCVQKERVTRVVDDDETDCENSGTVTENVK
DGRRRKTSIAWKHFTVQDSVRCIAKCKQCDKSVSYFSSVSNLMKHIDNKH
HGKKRKLSSEAQGKNSETETRKRIHTGKRNSIAWKYFTIKDHASKIATCT
LCGKSMSYSNVSNLMKHVKNVHRKHNNISDCRKNDNDDSENNAE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: INTERPRO
TermDefinition
IPR003656Znf_BED
IPR015880Znf_C2H2-like