HiSeq13538_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13538
Unique NameHiSeq13538_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length179
Homology
BLAST of HiSeq13538 vs. genbank:protein
Match: gi|357615241|gb|EHJ69546.1| (hypothetical protein KGM_05403 [Danaus plexippus])

HSP 1 Score: 70.0922 bits (170), Expect = 7.887e-11
Identity = 42/129 (32.56%), Postives = 67/129 (51.94%), Query Frame = 0
Query:    7 DIECKLIKTGRG-ILAMVQDYTFIRINRRSNIWTCSNRQSTQCRAKIRVHDETESLLEYHPDHNHPPPKYHINKQGLYCKAWIPEKNLGTDDDPYFVMRPKGMALLWGEHRYFKQKECKDSTIWRCSEY 134
            D++ + I + RG  L M+ DYTF RIN+   +W CS + S+QCRA++R+  +   + ++  +HNHPPPKY+                   +D   ++ +P G  LL  +   F  +  K S +W CS Y
Sbjct:  720 DMKYEFIASTRGGQLLMINDYTFSRINKTCYVWCCSAK-SSQCRARVRLSAD-NVITDFILEHNHPPPKYYKT----------------NNDRLTYITKPNGTVLLMLQGYTF-FRASKQSYVWLCSRY 829          
The following BLAST results are available for this feature:
BLAST of HiSeq13538 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|357615241|gb|EHJ69546.1|7.887e-1132.56hypothetical protein KGM_05403 [Danaus plexippus][more]
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007588Zinc finger, FLYWCH-typePFAMPF04500FLYWCHcoord: 106..155
e-value: 2.1E-7
score: 30.6
coord: 23..70
e-value: 2.4E-8
score: 33.6

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13538HiSeq13538Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13538_p ID=HiSeq13538_p|Name=HiSeq13538|organism=Ostrinia scapulalis|type=polypeptide|length=179bp
AVGDAQDIECKLIKTGRGILAMVQDYTFIRINRRSNIWTCSNRQSTQCRA
KIRVHDETESLLEYHPDHNHPPPKYHINKQGLYCKAWIPEKNLGTDDDPY
FVMRPKGMALLWGEHRYFKQKECKDSTIWRCSEYGKMGCLGSATVKDGCV
IRCKSHSCSETSFPNMDVKDEEENPEAET
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR007588Znf_FLYWCH