HiSeq13627_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13627
Unique NameHiSeq13627_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length273
Homology
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|299930595|gb|ADJ58513.1| (seminal fluid protein HACP007 [Heliconius erato])

HSP 1 Score: 215.698 bits (548), Expect = 3.804e-66
Identity = 113/264 (42.80%), Postives = 156/264 (59.09%), Query Frame = 0
Query:    6 FVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGHFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTSRDWIIAATHRLYVSNCPKK 269
             ++ IL    CF   SK    E RI  GY V +  Y ++ F++F    P++CG SL MVQAV+TAAHC+DE+ Y  G +  +FG +IP     VR++ ++ I+PKY  EKG+ NL + FL+  VPL   I KIP+ TK P V D ++++GWGKQ     P KLPD+S  R L+A+KQRV+   DC  Y G K+S+   CT    G+ +  DAGNGLV K     LVGV+S++ + I++ + V     WI  A   LY   C KK
Sbjct:    4 LMIFILYVSTCFG-LSKSNGTEGRIVKGYKVEMYSYPHSGFMHFRKYIPTACGSSLFMVQAVITAAHCLDEINYHNGDINIFFGASIPLHATIVRKIANFHIHPKYKAEKGQYNLGIGFLNAPVPLSDSISKIPIATKTPPVNDALYTSGWGKQV----PQKLPDYSDLRHLRASKQRVISLRDCEGYTGLKMSSAYWCTSSINGYHYHGDAGNGLVSKDK--FLVGVVSYMIDDITIYSDVTREVKWIKKAITSLYKEYCEKK 260          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|299930679|gb|ADJ58555.1| (seminal fluid protein HACP007 [Heliconius melpomene])

HSP 1 Score: 213.772 bits (543), Expect = 1.917e-65
Identity = 105/234 (44.87%), Postives = 149/234 (63.68%), Query Frame = 0
Query:   21 SKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGHFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTSRDWI 254
            SK    E RI  GY V + +Y +A F++F    P++CG SL MVQAV+TAAHC+DE+ Y+ G +  +FG +IP     VR+V ++ I+PKY+ EKG+ NL + FL+  VPL  +I KIP+ TK P V D ++++GWGKQ     P KLPD+S  R LKA+KQRV+   DC  Y G K+S+   CT+   G+ +  DAGNGLV K     LVGV+S++ + I++ + V     W+
Sbjct:   18 SKSNGTEGRIVKGYKVAVYKYPHAGFMHFRKHVPTACGSSLFMVQAVVTAAHCLDEINYNNGDINIFFGASIPLHAEIVRKVANFHIHPKYNAEKGQYNLGIGFLNAPVPLSDFISKIPIATKTPMVNDALYTSGWGKQV----PQKLPDYSDLRHLKASKQRVISLRDCEGYTGMKMSSAYWCTLSINGYHYHGDAGNGLVSKDK--FLVGVVSYMIDDITMYSDVTREVKWM 245          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|357629802|gb|EHJ78354.1| (hypothetical protein KGM_12840 [Danaus plexippus])

HSP 1 Score: 181.8 bits (460), Expect = 7.107e-53
Identity = 95/256 (37.11%), Postives = 146/256 (57.03%), Query Frame = 0
Query:   14 VRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGHFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTSRDWIIAATHRLYVSNCPKK 269
            + CF   S L   E RI  GY VGI  Y ++ FL+F+   P++CG +LI  Q+++T+A+C+ E+    G + AYFG ++P      RQV  + I+ +++ E G+ NL +A+L+  VPL++ I+KIP++ K PK  + + + GWGK    + P KLPD+S  R LKATKQR +    C      +++    CT+   GH +  D GNGLV       L+GV+SF+ N I+V + V   + WI      L+   C K+
Sbjct:    2 LHCFA-ISNLTAPERRIVEGYKVGIHLYPHSVFLHFQKDIPTACGATLITDQSIITSANCLYEVNIRNGKITAYFGASVPINANVKRQVELFSIHRRFNAETGKFNLGIAYLNKAVPLKNEIQKIPISVKLPKTNEALHTTGWGK----DVPGKLPDYSDLRHLKATKQRTISPRQCQNITKSRMTPAFWCTISINGHHYHGDDGNGLVNSEN--QLIGVVSFMVNDITVYSDVMREQLWIYTTVMDLFKKMCTKR 250          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|827557280|ref|XP_012549912.1| (PREDICTED: trypsin beta-like [Bombyx mori])

HSP 1 Score: 175.637 bits (444), Expect = 3.771e-51
Identity = 81/143 (56.64%), Postives = 105/143 (73.43%), Query Frame = 0
Query:   25 ELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTK 167
            +LE  IY GY+VGI  YSYA FL+F+TT P+SCG SLIMVQAVLTAAHC+D++R   G ++A+FG  +P     +R+V +YEINPKY+E  G+NNLAVAFL  RVPL+  IKKIPL+ ++P     +FS GWGKQ +   P +
Sbjct:   28 DLEPLIYKGYEVGIHDYSYACFLHFKTTRPTSCGASLIMVQAVLTAAHCMDDIRIKSGEIHAFFGSNVPKDSSVIRRVGNYEINPKYNEVNGKNNLAVAFLDYRVPLRQGIKKIPLSIRDPVPRTDLFSVGWGKQSIVGPPPQ 170          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|557780032|ref|XP_005189639.1| (PREDICTED: trypsin beta [Musca domestica])

HSP 1 Score: 93.2041 bits (230), Expect = 6.068e-19
Identity = 80/268 (29.85%), Postives = 125/268 (46.64%), Query Frame = 0
Query:    6 FVVLILVSVRCFNN---SSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDEL--RYSRGIMYAY--FGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCN-KYAGF-KVSATTLCTMPEIG--HFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVS----TGVFTS----RDWI 254
            FV+L L++     +      +P+LE R+  G D  IDQY Y   +         CGGS+   + V+TAAHC+       S  I Y     GG+  N     +++V    N KYD     N++A+ FLS  +P     + IPL + EP+   +    GWG        T   D + A  L+ T+  ++ R+ CN +YAG  +++   LC   E G     + D+G  LV       LVG++S+   G+  +    +GV+++    RDWI
Sbjct:    6 FVLLALMAASAMGSIIMPRLIPDLEGRVVGGEDTTIDQYPYQ--VSVRLLGSHVCGGSIYNSRVVVTAAHCIYSFLGASSYSIQYGVTKVGGS--NNVIGAQRIVK---NEKYDSSSINNDVALIFLSSDIPFSATAQPIPLASAEPEPTTVAVVTGWG--------TTEEDGASASILQKTEVLIVARDVCNSQYAGINEITNVMLCAAVENGGKDACQGDSGGPLVANGE---LVGIVSW---GVGCARADFSGVYSNVAELRDWI 252          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|194759700|ref|XP_001962085.1| (uncharacterized protein Dana_GF15290 [Drosophila ananassae] >gi|190615782|gb|EDV31306.1| uncharacterized protein Dana_GF15290 [Drosophila ananassae])

HSP 1 Score: 86.6557 bits (213), Expect = 1.167e-16
Identity = 71/259 (27.41%), Postives = 117/259 (45.17%), Query Frame = 0
Query:    4 VFFVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCT-MPEIGHFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTS----RDWIIAA 257
            ++ +VL+L+S      +S   +   RI  G DV I++  +   L  +      CGGS+     ++TAAHCVD  +Y    +    G +  N    + QV   + + KY++ +G N++AV  L++ +P+   I+ I L  +EP       S GWG  R+     + PD      L+    ++  R  C   + + +    LC  +    H F D  G  +V+K     LVG+ S   N   +S G + S    R WI+ A
Sbjct:    1 MYTLVLVLLSFTALLAASPGSQ---RIIGGQDVQIEKVPWQVSL--QVDGQHFCGGSIYNESFIVTAAHCVD--KYPAENLAIRAGSSYKNNGGVLVQVAATKFHEKYNKRRGENDVAVIRLANPLPIGDNIQPITLAEEEPAEGSPALSTGWGATRIGIFGGRYPD-----KLQGVNIKIENRQKCKWTSLWSMLDDDLCAGVVGHAHCFGDSGGPLVVEK----TLVGISSRTGNAFCLSPGYYVSVAKFRPWILKA 243          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|1189075962|ref|XP_020805952.1| (trypsin alpha-4 [Drosophila serrata])

HSP 1 Score: 83.5741 bits (205), Expect = 1.822e-15
Identity = 71/258 (27.52%), Postives = 116/258 (44.96%), Query Frame = 0
Query:    6 FVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGHFFK----DDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTS----RDWII 255
            F+ + LVS+   N    +P+   RI  G+D  ID+  +   +  +     +CGGS+     ++TAAHCV  L+   G +    G +  N    V +V  ++ + +YD     N++AV  L D + L  YI+ IPL   +P       S GWG   +         FS    L+    ++  ++ C     F+V  T +C     GH  K     D+G  LV       LVG++S   N + +++G++ S    R WI+
Sbjct:    7 FLWISLVSLLTANPDISVPQ--DRILGGHDTEIDEAPWQ--VSLQKNGIHNCGGSIYSQTIIITAAHCVHGLK--TGTLSIRAGSSKHNSGGIVVKVAAFKYHERYDSVTIHNDVAVILLKDPLALSPYIQSIPLAKTDPAEGSQALSTGWGSTGL---------FSPIH-LQGVDLKIESKSFCRLKYPFRVYKTDICA----GHLGKAVCRGDSGGPLVVNGK---LVGIVSRSGNILCLASGLYVSVAHYRKWIL 241          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|751791058|ref|XP_011205110.1| (PREDICTED: serine protease SP24D-like [Bactrocera dorsalis])

HSP 1 Score: 82.0333 bits (201), Expect = 6.922e-15
Identity = 75/263 (28.52%), Postives = 114/263 (43.35%), Query Frame = 0
Query:    2 LTVFFVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSS---CGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGH-FFKDDAGNGLVQKHPVLVLVGVLSFVSNGIS-----VSTGVFTSRDWII 255
            + + F ++  +SV   +  S+ P ++ RIYSG      Q+ Y   L+ E  +  S   CGGS+I    +LTAAHC+   +    I    + GTI     A R+V    I+P Y E    N++AV  L+  +     I  IPL  K+      V  +GWG          +  F  A  L+   +  + R  C +  G  + +T  C    +GH     D+G   V       LVGV S++ N        V T V  +R+WI+
Sbjct:    7 ILIIFALIAAISVNFSSGKSRSP-VQPRIYSGRSAAKRQFPYQVLLHIEDAAHKSLYACGGSIISRDHILTAAHCIAHAKTPGDI--TVYAGTIYYADAAERRVSQMTIHPAYGEYN--NDIAVLKLNTSLKFSDVIDAIPLAKKDIPDGAPVIVSGWG---------HVNRFKAAYILQYDTEYSISRAQCLRRLG-TLGSTMRCMRRPLGHGTCSGDSGGPAVHNGE---LVGVNSYIINDCGLGFPDVFTDVVATREWIL 251          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|1036887704|ref|XP_017047444.1| (PREDICTED: trypsin beta-like isoform X1 [Drosophila ficusphila])

HSP 1 Score: 81.6481 bits (200), Expect = 1.075e-14
Identity = 71/264 (26.89%), Postives = 118/264 (44.70%), Query Frame = 0
Query:    4 VFFVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCVDE--LRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVT-EKPTKLP----DFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTMPEIGHFFKDDAGNGLVQKHPVLVLVGVLSF---VSNGISVSTGVFTSRDWIIAA 257
            +F   ++L+S   F ++ +LP+ E RI  G ++ I+   +   L F       CGGS+     ++TAAHC+ +  +           G ++ +    + QV   + + KY+     N++AV  LS+ +     ++ IPL  K P  E +  ++GWG   VT  K   LP    D      L++T  R++   +C +Y     +   +C           D+G  LV       LVGV SF   V N  S   G+ + R+WI+ A
Sbjct:    1 MFIKCILLLSAINFLSAGRLPQPEERILGGKNIEIEDAPWQVSLQF--LGKHRCGGSIYSKDIIITAAHCLLDKGVELKAEDFQVRVGSSLKSSDGTLIQVEAIKSHEKYNNLTIVNDIAVMRLSESLEFSSKVQPIPLAEKNPLPESLAMASGWGAVTVTVTKDHSLPIVWVDKEHPEHLQSTLLRII---NCREYQ--DATEDNICVNTPGQSTCMGDSGGPLVVDQQ---LVGVTSFGSKVCNNTSAFAGIPSFRNWILNA 254          
BLAST of HiSeq13627 vs. genbank:protein
Match: gi|766930949|ref|XP_011497634.1| (PREDICTED: chymotrypsin-1-like [Ceratosolen solmsi marchali])

HSP 1 Score: 79.337 bits (194), Expect = 5.470e-14
Identity = 63/233 (27.04%), Postives = 102/233 (43.78%), Query Frame = 0
Query:   11 LVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFETTSPSSCGGSLIMVQAVLTAAHCV-DELRYSRGIMYAYFGGTIPNKFRAVRQVVDYEINPKYD----EEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDIVFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSATTLCTM--PEIGHFFKDDAGNGLVQKHPVLVLVGVLSF 236
            +V   CF+  + +   ESRIY G    I ++ +   +  + ++   CGGS+I  + +LTAAHC+ D LRY  G+       T+ + +    ++ D  ++P  D    +    +++A+  LS ++   +   KI L T+ PK  D    AGWGK           D   +  L  +   +L   DC       +  T  CT     IG    DD G+ +        L GV+SF
Sbjct:    5 IVICLCFSLFTDVFSKESRIYGGNPAAIHEFPHLVSIRTDYSNQHLCGGSIISQRNILTAAHCLRDVLRYLEGVKVYTGTATVNDIYGNAVRIQDVHLHPHCDIMNPDSTFYHDIAMIKLSTKIEFNNLQNKIALPTRAPKTGDFATIAGWGKTEY--------DLINSPILMQSPVVILNNTDCASRVPLPMGDTQFCTYYSAGIGICSGDDGGSVVSNGE----LYGVISF 225          
The following BLAST results are available for this feature:
BLAST of HiSeq13627 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|299930595|gb|ADJ58513.1|3.804e-6642.80seminal fluid protein HACP007 [Heliconius erato][more]
gi|299930679|gb|ADJ58555.1|1.917e-6544.87seminal fluid protein HACP007 [Heliconius melpomen... [more]
gi|357629802|gb|EHJ78354.1|7.107e-5337.11hypothetical protein KGM_12840 [Danaus plexippus][more]
gi|827557280|ref|XP_012549912.1|3.771e-5156.64PREDICTED: trypsin beta-like [Bombyx mori][more]
gi|557780032|ref|XP_005189639.1|6.068e-1929.85PREDICTED: trypsin beta [Musca domestica][more]
gi|194759700|ref|XP_001962085.1|1.167e-1627.41uncharacterized protein Dana_GF15290 [Drosophila a... [more]
gi|1189075962|ref|XP_020805952.1|1.822e-1527.52trypsin alpha-4 [Drosophila serrata][more]
gi|751791058|ref|XP_011205110.1|6.922e-1528.52PREDICTED: serine protease SP24D-like [Bactrocera ... [more]
gi|1036887704|ref|XP_017047444.1|1.075e-1426.89PREDICTED: trypsin beta-like isoform X1 [Drosophil... [more]
gi|766930949|ref|XP_011497634.1|5.470e-1427.04PREDICTED: chymotrypsin-1-like [Ceratosolen solmsi... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0004252 serine-type endopeptidase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001254Peptidase S1SMARTSM00020Tryp_SPccoord: 29..254
e-value: 3.0E-12
score: 56.7
IPR001254Peptidase S1PFAMPF00089Trypsincoord: 40..254
e-value: 2.6E-22
score: 79.4
IPR001254Peptidase S1PROSITEPS50240TRYPSIN_DOMcoord: 30..259
score: 14.794
NoneNo IPR availableGENE3D2.40.10.10coord: 68..256
e-value: 2.4E-27
score: 95.5
NoneNo IPR availableGENE3D2.40.10.10coord: 30..67
e-value: 4.5E-10
score: 38.5
NoneNo IPR availablePANTHERPTHR24260FAMILY NOT NAMEDcoord: 23..254
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 17..273
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 2..12
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..1
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..16
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 13..16
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.845
IPR018114Peptidase S1, trypsin family, active sitePROSITEPS00134TRYPSIN_HIScoord: 68..73
IPR009003Trypsin-like cysteine/serine peptidase domainSUPERFAMILY50494Trypsin-like serine proteasescoord: 7..258

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13627HiSeq13627Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13627_p ID=HiSeq13627_p|Name=HiSeq13627|organism=Ostrinia scapulalis|type=polypeptide|length=273bp
MLTVFFVVLILVSVRCFNNSSKLPELESRIYSGYDVGIDQYSYASFLYFE
TTSPSSCGGSLIMVQAVLTAAHCVDELRYSRGIMYAYFGGTIPNKFRAVR
QVVDYEINPKYDEEKGRNNLAVAFLSDRVPLQHYIKKIPLTTKEPKVEDI
VFSAGWGKQRVTEKPTKLPDFSKARSLKATKQRVLGRNDCNKYAGFKVSA
TTLCTMPEIGHFFKDDAGNGLVQKHPVLVLVGVLSFVSNGISVSTGVFTS
RDWIIAATHRLYVSNCPKKTKKS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: INTERPRO
TermDefinition
IPR009003Trypsin-like_Pept_dom
IPR018114Peptidase_S1_AS
IPR001254Peptidase_S1