HiSeq13630_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13630
Unique NameHiSeq13630_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length409
Homology
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|913297187|ref|XP_013187437.1| (PREDICTED: coiled-coil domain-containing protein 6-like isoform X1 [Amyelois transitella])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 358/410 (87.32%), Postives = 365/410 (89.02%), Query Frame = 0
Query:   13 LDGGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLPGTGLPRPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEPGAC-------------PAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            LDGGAMLPPS +SRDQLQKRIESLQQQNRVLKVE+DTYKLRVK+LQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQL+VSQNENKEKMHR ALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPY PPL+P     RP+MH NSQ RRPSDRFVKPAVP  GG        PG                 PP        PAPPLLQP+SPMDTSSKD
Sbjct:   24 LDGGAMLPPSAVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKSLQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLSVSQNENKEKMHRLALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYGPPLMPNAPGLRPAMHFNSQQRRPSDRFVKPAVPVAGG-------SPGVARGGEAAAGLPAAASTPP-------RPAPPLLQPASPMDTSSKD 419          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|512929718|ref|XP_004931892.1| (PREDICTED: coiled-coil domain-containing protein 6 isoform X1 [Bombyx mori])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 358/398 (89.95%), Postives = 366/398 (91.96%), Query Frame = 0
Query:   13 LDGGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLPRPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            LDGGAMLPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENR+LRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREEN+RLQRKLQQEVERREALCRHLSESESSLEMEEERQFNE   ARSRSVSSPGGSRPLSPYA PLLP G GL RP +HLN+Q RRPSDRFVKPAVP    L   P  E G  PAPP+           LLQP+SPMDTSSKD
Sbjct:   24 LDGGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENMRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNETFGARSRSVSSPGGSRPLSPYASPLLPSGAGL-RPGLHLNAQGRRPSDRFVKPAVPAGAPL---PGREAGG-PAPPS-----------LLQPASPMDTSSKD 405          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|913297189|ref|XP_013187444.1| (PREDICTED: coiled-coil domain-containing protein 6-like isoform X2 [Amyelois transitella])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 355/410 (86.59%), Postives = 362/410 (88.29%), Query Frame = 0
Query:   13 LDGGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLPGTGLPRPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEPGAC-------------PAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            LDGGAMLPPS +SRDQLQKRIESLQQQNRVLKVE+DTYKLRVK+LQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASP   SNGDTASNLSNHIQTLRSEVVKLRNQL+VSQNENKEKMHR ALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPY PPL+P     RP+MH NSQ RRPSDRFVKPAVP  GG        PG                 PP        PAPPLLQP+SPMDTSSKD
Sbjct:   24 LDGGAMLPPSAVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKSLQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASP---SNGDTASNLSNHIQTLRSEVVKLRNQLSVSQNENKEKMHRLALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYGPPLMPNAPGLRPAMHFNSQQRRPSDRFVKPAVPVAGG-------SPGVARGGEAAAGLPAAASTPP-------RPAPPLLQPASPMDTSSKD 416          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|827559619|ref|XP_012550802.1| (PREDICTED: coiled-coil domain-containing protein 6 isoform X2 [Bombyx mori])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 355/398 (89.20%), Postives = 363/398 (91.21%), Query Frame = 0
Query:   13 LDGGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLPRPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            LDGGAMLPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENR+LRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASP   SNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREEN+RLQRKLQQEVERREALCRHLSESESSLEMEEERQFNE   ARSRSVSSPGGSRPLSPYA PLLP G GL RP +HLN+Q RRPSDRFVKPAVP    L   P  E G  PAPP+           LLQP+SPMDTSSKD
Sbjct:   24 LDGGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASP---SNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENMRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNETFGARSRSVSSPGGSRPLSPYASPLLPSGAGL-RPGLHLNAQGRRPSDRFVKPAVPAGAPL---PGREAGG-PAPPS-----------LLQPASPMDTSSKD 402          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|943961830|ref|XP_014363358.1| (PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing protein 6 [Papilio machaon])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 356/410 (86.83%), Postives = 367/410 (89.51%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLP--RPSMHLNSQSRR-PSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLA-----------APAPPLLQPSSPMDTSSKD 409
            GGAMLPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLE TLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEK+IR+ENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEA+ ARSRSVSSPGGSRPLSPYA PLLP   GLP  RP++H NSQ+RR  S+RFVKPAVPG   L RA PL+P A         P              P  PL QP+SPMDTSSKD
Sbjct:   26 GGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLELTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKYIRDENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEAMGARSRSVSSPGGSRPLSPYASPLLPNAAGLPMSRPNIHFNSQARRGTSERFVKPAVPGASLLCRAGPLDPPAPGPHAPHAPPPHSPAPPSPLAPHTPLAPLQQPASPMDTSSKD 435          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|930670569|gb|KPJ11385.1| (Coiled-coil domain-containing protein 6 [Papilio machaon])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 352/410 (85.85%), Postives = 363/410 (88.54%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLP--RPSMHLNSQSRR-PSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLA-----------APAPPLLQPSSPMDTSSKD 409
            GGAMLPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLE TLEQEQECLVNKLMRKIEKLEAETLAKQTNLERL    VELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEK+IR+ENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEA+ ARSRSVSSPGGSRPLSPYA PLLP   GLP  RP++H NSQ+RR  S+RFVKPAVPG   L RA PL+P A         P              P  PL QP+SPMDTSSKD
Sbjct:   26 GGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLELTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERL---SVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKYIRDENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEAMGARSRSVSSPGGSRPLSPYASPLLPNAAGLPMSRPNIHFNSQARRGTSERFVKPAVPGASLLCRAGPLDPPAPGPHAPHAPPPHSPAPPSPLAPHTPLAPLQQPASPMDTSSKD 432          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|909571529|ref|XP_013141361.1| (PREDICTED: coiled-coil domain-containing protein 6-like isoform X1 [Papilio polytes])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 347/404 (85.89%), Postives = 362/404 (89.60%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLPGTGLP--RPSMHLNSQSRR-PSDRFVKPAVPGV-----GGLGRAPPLEPGACPAPPAVLLPLAA-PAPPLLQPSSPMDTSSKD 409
            G AMLPPS +SRDQLQKRIESLQQQNRVLKVE+DTYKL VKALQEENRALRQASVSIQAKAEQE+EYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQL QEKCRLE TLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEK+IR+EN+RLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEA+ ARSRSVSSPGGSRPLSPY+ PLLP  GLP  R ++H NSQ+RR  S+RFVKPAVPG       GL + P     A P       P A+ P  PL QP+SPMDTSSKD
Sbjct:   26 GVAMLPPSNVSRDQLQKRIESLQQQNRVLKVELDTYKLHVKALQEENRALRQASVSIQAKAEQEKEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLHQEKCRLELTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKYIRDENVRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEAMGARSRSVSSPGGSRPLSPYS-PLLPSAGLPIARHNIHFNSQARRGTSERFVKPAVPGASLLCRAGLEQPPAPPLPAAPPALPPHTPRASTPHSPLEQPASPMDTSSKD 428          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|910348194|ref|XP_013178061.1| (PREDICTED: coiled-coil domain-containing protein 6 isoform X1 [Papilio xuthus])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 347/412 (84.22%), Postives = 362/412 (87.86%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLP--RPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEP--------------GACPAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            GG  LPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENRALRQASVSIQAKAEQE+EYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQL QEKCRLE TLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREK+ELENTLEQEQEALVNRLWKRMDKLEAEKRSL IRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEK+IR+EN+RLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEA+ ARSRSVSSPGGSRPLSPYA PLLP   GLP  RP+MH NSQ+RR  +RFVKPAVPG   L R  P++P               A P         +A   PL QP+SPMDTSSKD
Sbjct:   26 GGERLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRALRQASVSIQAKAEQEKEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLHQEKCRLELTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKIELENTLEQEQEALVNRLWKRMDKLEAEKRSLHIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKYIRDENIRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEAMGARSRSVSSPGGSRPLSPYASPLLPNAAGLPMSRPNMHFNSQTRR-CERFVKPAVPGASLLCRGGPMDPLSPAPHAPHAPHASPAPPPLSPAPPSPSAALAPLQQPASPMDTSSKD 436          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|930655567|gb|KPI97895.1| (Coiled-coil domain-containing protein 6 [Papilio xuthus])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 331/365 (90.68%), Postives = 344/365 (94.25%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLP-GTGLP--RPSMHLNSQSRRPSDRFVKPAVPGVGGLGRAPPLEP 376
            GG  LPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENRALRQASVSIQAKAEQE+EYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQL QEKCRLE TLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREK+ELENTLEQEQEALVNRLWKRMDKLEAEKRSL IRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEK+IR+EN+RLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEA+ ARSRSVSSPGGSRPLSPYA PLLP   GLP  RP+MH NSQ+RR  +RFVKPAVPG   L R  P++P
Sbjct:   26 GGERLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRALRQASVSIQAKAEQEKEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLHQEKCRLELTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKIELENTLEQEQEALVNRLWKRMDKLEAEKRSLHIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKYIRDENIRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEAMGARSRSVSSPGGSRPLSPYASPLLPNAAGLPMSRPNMHFNSQTRR-CERFVKPAVPGASLLCRGGPMDP 389          
BLAST of HiSeq13630 vs. genbank:protein
Match: gi|357613392|gb|EHJ68478.1| (hypothetical protein KGM_16649 [Danaus plexippus])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 341/396 (86.11%), Postives = 355/396 (89.65%), Query Frame = 0
Query:   15 GGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQNENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEMEEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLPGTGLPRPSMHLNS-QSRRPSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLAAPAPPLLQPSSPMDTSSKD 409
            GGAMLPPST+SRDQLQKRIESLQQQNRVLKVE+DTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAET AKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLS+HIQTLRSEVVKLRNQLA SQNE+KEKM RFALEEKHIREEN+RL RKLQQEVERREALCRHLSESESSLEMEEERQFNEAL+ARSRSVSSPGGSRPLSPYA          RP++H NS Q+RR S+RFVKPAVPG G     PP      P   A      AP  P +QP+SPMDTSS++
Sbjct:   26 GGAMLPPSTVSRDQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEKLEAETFAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRSLQIRLDQPVSDPASPRDISNGDTASNLSSHIQTLRSEVVKLRNQLAFSQNESKEKMQRFALEEKHIREENVRLHRKLQQEVERREALCRHLSESESSLEMEEERQFNEALNARSRSVSSPGGSRPLSPYAL-----HNPARPALHFNSQQARRASERFVKPAVPGAG--VSLPP----RVPLESASAPAPPAPPSPSMQPASPMDTSSRE 410          
The following BLAST results are available for this feature:
BLAST of HiSeq13630 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913297187|ref|XP_013187437.1|0.000e+087.32PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|512929718|ref|XP_004931892.1|0.000e+089.95PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|913297189|ref|XP_013187444.1|0.000e+086.59PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|827559619|ref|XP_012550802.1|0.000e+089.20PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|943961830|ref|XP_014363358.1|0.000e+086.83PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain... [more]
gi|930670569|gb|KPJ11385.1|0.000e+085.85Coiled-coil domain-containing protein 6 [Papilio m... [more]
gi|909571529|ref|XP_013141361.1|0.000e+085.89PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|910348194|ref|XP_013178061.1|0.000e+084.22PREDICTED: coiled-coil domain-containing protein 6... [more]
gi|930655567|gb|KPI97895.1|0.000e+090.68Coiled-coil domain-containing protein 6 [Papilio x... [more]
gi|357613392|gb|EHJ68478.1|0.000e+086.11hypothetical protein KGM_16649 [Danaus plexippus][more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 184..205
NoneNo IPR availableCOILSCoilCoilcoord: 224..252
NoneNo IPR availableCOILSCoilCoilcoord: 26..75
NoneNo IPR availableCOILSCoilCoilcoord: 87..183
NoneNo IPR availablePANTHERPTHR15276:SF0COILED-COIL DOMAIN-CONTAINING PROTEIN 6coord: 1..363
IPR019152Protein of unknown function DUF2046PFAMPF09755DUF2046coord: 5..309
e-value: 2.3E-155
score: 515.9
IPR019152Protein of unknown function DUF2046PANTHERPTHR15276H4(D10S170) PROTEIN-RELATEDcoord: 1..363

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13630HiSeq13630Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13630_p ID=HiSeq13630_p|Name=HiSeq13630|organism=Ostrinia scapulalis|type=polypeptide|length=409bp
MADSASESDSSSLDGGAMLPPSTISRDQLQKRIESLQQQNRVLKVEVDTY
KLRVKALQEENRALRQASVSIQAKAEQEEEYISNTLLKKIQALKKEKETL
AHHYEREEECLTNDLSRKLNQLRQEKCRLEQTLEQEQECLVNKLMRKIEK
LEAETLAKQTNLERLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRS
LQIRLDQPVSDPASPRDISNGDTASNLSNHIQTLRSEVVKLRNQLAVSQN
ENKEKMHRFALEEKHIREENLRLQRKLQQEVERREALCRHLSESESSLEM
EEERQFNEALSARSRSVSSPGGSRPLSPYAPPLLPGTGLPRPSMHLNSQS
RRPSDRFVKPAVPGVGGLGRAPPLEPGACPAPPAVLLPLAAPAPPLLQPS
SPMDTSSKD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR019152DUF2046