HiSeq13631_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13631
Unique NameHiSeq13631_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length210
Homology
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|909581092|ref|XP_013146518.1| (PREDICTED: uncharacterized protein LOC106109531, partial [Papilio polytes])

HSP 1 Score: 263.462 bits (672), Expect = 2.812e-84
Identity = 112/162 (69.14%), Postives = 145/162 (89.51%), Query Frame = 0
Query:    1 LQMTAELVPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSK 162
            L MTAELVP++SG+DSTYPV++W++D+E   EIF W+PLQQLLVARRSL GTA+LWL++ERPF SW++LK+ I+KEFP T+D KA+HE+MSARKK+ +E+CLDY+LIMKE+GKRGK+ DY+ IKYI+DGI+D E+NK+MLYG+ TYS+LKEKLKIYE + SK
Sbjct:   24 LHMTAELVPKFSGQDSTYPVSKWIQDIEDTGEIFKWAPLQQLLVARRSLIGTAELWLKSERPFMSWEELKSEISKEFPSTLDAKAVHEVMSARKKKRNESCLDYLLIMKEMGKRGKLADYITIKYIIDGIIDHESNKIMLYGIKTYSELKEKLKIYEMVKSK 185          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768410013|ref|XP_011555949.1| (PREDICTED: uncharacterized protein LOC105386985 [Plutella xylostella])

HSP 1 Score: 250.366 bits (638), Expect = 8.522e-81
Identity = 115/168 (68.45%), Postives = 140/168 (83.33%), Query Frame = 0
Query:    1 LQMTAELVPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQKSSV 168
            +    ELVP++SG+D  Y  +RWVEDVE NAEIFGWS LQQL+VARRSLTGTA LWLRAE+PFK+WD LK+AI KEFP TVD KAIHE+MSARKK+  E+C+DY+L+MKEL KRG++ D VAI+YI+DGIVD E NK+MLYG TTYS+LK+KL+IYET+  KM+   V
Sbjct:   35 MNYAEELVPKFSGQDRMYVASRWVEDVEDNAEIFGWSALQQLVVARRSLTGTASLWLRAEKPFKTWDALKSAILKEFPGTVDGKAIHEIMSARKKQQGESCIDYLLVMKELAKRGELADSVAIQYIIDGIVDAENNKIMLYGATTYSELKDKLRIYETVKEKMKTPQV 202          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768439800|ref|XP_011561551.1| (PREDICTED: uncharacterized protein LOC105391716 [Plutella xylostella])

HSP 1 Score: 253.062 bits (645), Expect = 2.241e-77
Identity = 118/169 (69.82%), Postives = 139/169 (82.25%), Query Frame = 0
Query:    1 LQMTAELVPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQKSSVP 169
            L  T ELV ++SG D T   TRW ++V+ NAEIFGW+ LQ+L+V RRSLTGTA LWLR+E+PFK+W+ LK A+TKEFPDTVD K IHELMS+RKK+ +ETCLDYML+MKELGKRGKMPDYVAIKYIVDGI+D E +K+MLYGVTTY DLKEKLK+YETI  K      P
Sbjct:   19 LTYTEELVAKFSGCDQTDSATRWAQEVDDNAEIFGWTELQRLIVGRRSLTGTAALWLRSEKPFKTWEALKTAVTKEFPDTVDSKTIHELMSSRKKKANETCLDYMLLMKELGKRGKMPDYVAIKYIVDGILDDELHKVMLYGVTTYGDLKEKLKVYETIRQKSSGRRAP 187          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768442324|ref|XP_011562930.1| (PREDICTED: uncharacterized protein LOC105392935 [Plutella xylostella])

HSP 1 Score: 249.98 bits (637), Expect = 5.382e-76
Identity = 116/169 (68.64%), Postives = 138/169 (81.66%), Query Frame = 0
Query:    1 LQMTAELVPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQKSSVP 169
            L  T ELV ++SG D T    RW ++V+ NAEIFGW+ LQ+L+V RRSLTGTA LWLR+E+PFK+W+ LK A+TKEFPDTVD K IHELMS+RKK+ +ETCLDYML+MKELGKRGKMPDYVAIKYIVDGI+D E +K+MLYGVTTY DLK+KLK+YETI  K      P
Sbjct:   19 LTYTEELVAKFSGCDQTDSAARWAQEVDDNAEIFGWTELQRLIVGRRSLTGTAALWLRSEKPFKTWEALKTAVTKEFPDTVDSKTIHELMSSRKKKANETCLDYMLLMKELGKRGKMPDYVAIKYIVDGILDDELHKVMLYGVTTYGDLKDKLKVYETIRQKSSGRRAP 187          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768445475|ref|XP_011564640.1| (PREDICTED: protein son of sevenless-like [Plutella xylostella])

HSP 1 Score: 238.81 bits (608), Expect = 5.992e-74
Identity = 109/153 (71.24%), Postives = 133/153 (86.93%), Query Frame = 0
Query:   12 SGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQ 164
             G+D  Y  +RWVEDVE NAEIFGWS LQ+L+VARRSLTGTA LWLRAE+PFK+W+ LK+AI  EFPDTVD KA HE+MSARKK+ +E+C+DY+L+MKEL KRG++ D VAI+YI+DGIVD+ETNK+MLYG TTYSDLKEKL+IYET+  KM+
Sbjct:  168 CGQDRMYVASRWVEDVEDNAEIFGWSALQKLVVARRSLTGTAALWLRAEKPFKTWNALKSAILNEFPDTVDGKASHEIMSARKKQQEESCIDYLLVMKELAKRGELVDSVAIQYIIDGIVDVETNKIMLYGATTYSDLKEKLRIYETVKKKMK 320          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|909573167|ref|XP_013142234.1| (PREDICTED: uncharacterized protein LOC106106229 isoform X3 [Papilio polytes])

HSP 1 Score: 214.157 bits (544), Expect = 5.440e-66
Identity = 101/196 (51.53%), Postives = 139/196 (70.92%), Query Frame = 0
Query:    8 VPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSK------MQKSSV-PRNEAESFKQXSKGGKVTGASGVTAVAT 196
            +PR++G D TY  TRW +D+E NA+IF W+P Q+L++ARR L+GTA+LW + E+ F ++++LKAA+ KEFP++V+ K +HE+MS RKKR +ET   YMLIMKELGKR K PDYV+I+YI+DGI D E NK++LYGVTTY  LKEKL +YET   K      M++ SV PR     F++  +  K   A  ++   T
Sbjct:   16 LPRFTGDDVTYTATRWAQDIEDNAQIFAWNPQQKLIIARRCLSGTAELWAKTEKTFGTYEELKAALLKEFPESVNCKEMHEMMSGRKKRPNETYYQYMLIMKELGKRAKFPDYVSIQYIIDGIDDYEANKILLYGVTTYPVLKEKLNLYETFKQKQKQEFEMRQHSVRPRAVECDFRKTLRCYKCGEAGHLSNSCT 211          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|909573163|ref|XP_013142232.1| (PREDICTED: uncharacterized protein LOC106106229 isoform X1 [Papilio polytes])

HSP 1 Score: 214.157 bits (544), Expect = 1.021e-65
Identity = 101/196 (51.53%), Postives = 139/196 (70.92%), Query Frame = 0
Query:    8 VPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSK------MQKSSV-PRNEAESFKQXSKGGKVTGASGVTAVAT 196
            +PR++G D TY  TRW +D+E NA+IF W+P Q+L++ARR L+GTA+LW + E+ F ++++LKAA+ KEFP++V+ K +HE+MS RKKR +ET   YMLIMKELGKR K PDYV+I+YI+DGI D E NK++LYGVTTY  LKEKL +YET   K      M++ SV PR     F++  +  K   A  ++   T
Sbjct:   16 LPRFTGDDVTYTATRWAQDIEDNAQIFAWNPQQKLIIARRCLSGTAELWAKTEKTFGTYEELKAALLKEFPESVNCKEMHEMMSGRKKRPNETYYQYMLIMKELGKRAKFPDYVSIQYIIDGIDDYEANKILLYGVTTYPVLKEKLNLYETFKQKQKQEFEMRQHSVRPRAVECDFRKTLRCYKCGEAGHLSNSCT 211          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|909573165|ref|XP_013142233.1| (PREDICTED: uncharacterized protein LOC106106229 isoform X2 [Papilio polytes])

HSP 1 Score: 213.772 bits (543), Expect = 1.259e-65
Identity = 101/196 (51.53%), Postives = 139/196 (70.92%), Query Frame = 0
Query:    8 VPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSK------MQKSSV-PRNEAESFKQXSKGGKVTGASGVTAVAT 196
            +PR++G D TY  TRW +D+E NA+IF W+P Q+L++ARR L+GTA+LW + E+ F ++++LKAA+ KEFP++V+ K +HE+MS RKKR +ET   YMLIMKELGKR K PDYV+I+YI+DGI D E NK++LYGVTTY  LKEKL +YET   K      M++ SV PR     F++  +  K   A  ++   T
Sbjct:   16 LPRFTGDDVTYTATRWAQDIEDNAQIFAWNPQQKLIIARRCLSGTAELWAKTEKTFGTYEELKAALLKEFPESVNCKEMHEMMSGRKKRPNETYYQYMLIMKELGKRAKFPDYVSIQYIIDGIDDYEANKILLYGVTTYPVLKEKLNLYETFKQKQKQEFEMRQHSVRPRAVECDFRKTLRCYKCGEAGHLSNSCT 211          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768427700|ref|XP_011554954.1| (PREDICTED: uncharacterized protein LOC105386148 [Plutella xylostella])

HSP 1 Score: 216.853 bits (551), Expect = 1.106e-64
Identity = 101/171 (59.06%), Postives = 126/171 (73.68%), Query Frame = 0
Query:    8 VPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQKSSVPRNEAESFKQ 178
            + +++G D TY   +W  D+E NAEIFGW+  Q+L+VARRSL GTA+LWLR E+ FK++D+L AA+ KEFPD ++ K +HELM+ RKK+ DET   YML MKELGKR K  DYVAI+YIVDGI D E NK +LYGVTTYS LKEKL IYE    KM+  +V + E ES  Q
Sbjct:   27 ITKFNGEDKTYSSAKWAADIEDNAEIFGWTAQQKLIVARRSLVGTAELWLRTEKTFKTFDELSAALQKEFPDALNSKEMHELMATRKKKKDETYYQYMLTMKELGKRAKFADYVAIQYIVDGITDYENNKAILYGVTTYSVLKEKLAIYE----KMKSKTVKKTEVESKTQ 193          
BLAST of HiSeq13631 vs. genbank:protein
Match: gi|768429994|ref|XP_011556201.1| (PREDICTED: fasciclin-1-like [Plutella xylostella])

HSP 1 Score: 221.09 bits (562), Expect = 1.101e-63
Identity = 101/168 (60.12%), Postives = 131/168 (77.98%), Query Frame = 0
Query:    8 VPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLTGTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDETCLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLKEKLKIYETIVSKMQKSSVPRNEAES 175
            +PR++G D TYP  RWVE++  NAEIFGWSP Q+LL+ARR+LTG A LWLR E  FK++++L+ A+ +EFP  V+ K IHELM+ RKK+ DE+C +YML+MKELGKRG   DYVAI+YIVDGI D   +K+MLYGVTTY DLKEKLKIYE +  KM+  +  R E+++
Sbjct:    9 IPRFTGADPTYPAARWVEEINDNAEIFGWSPSQKLLMARRALTGVAGLWLRTENTFKTFEELQRALLEEFPYDVNPKVIHELMTNRKKKRDESCYEYMLVMKELGKRGGFEDYVAIQYIVDGIEDCVIHKVMLYGVTTYPDLKEKLKIYEYMKRKMEMRARTRRESQA 176          
The following BLAST results are available for this feature:
BLAST of HiSeq13631 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909581092|ref|XP_013146518.1|2.812e-8469.14PREDICTED: uncharacterized protein LOC106109531, p... [more]
gi|768410013|ref|XP_011555949.1|8.522e-8168.45PREDICTED: uncharacterized protein LOC105386985 [P... [more]
gi|768439800|ref|XP_011561551.1|2.241e-7769.82PREDICTED: uncharacterized protein LOC105391716 [P... [more]
gi|768442324|ref|XP_011562930.1|5.382e-7668.64PREDICTED: uncharacterized protein LOC105392935 [P... [more]
gi|768445475|ref|XP_011564640.1|5.992e-7471.24PREDICTED: protein son of sevenless-like [Plutella... [more]
gi|909573167|ref|XP_013142234.1|5.440e-6651.53PREDICTED: uncharacterized protein LOC106106229 is... [more]
gi|909573163|ref|XP_013142232.1|1.021e-6551.53PREDICTED: uncharacterized protein LOC106106229 is... [more]
gi|909573165|ref|XP_013142233.1|1.259e-6551.53PREDICTED: uncharacterized protein LOC106106229 is... [more]
gi|768427700|ref|XP_011554954.1|1.106e-6459.06PREDICTED: uncharacterized protein LOC105386148 [P... [more]
gi|768429994|ref|XP_011556201.1|1.101e-6360.12PREDICTED: fasciclin-1-like [Plutella xylostella][more]

Pages

back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13631HiSeq13631Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13631_p ID=HiSeq13631_p|Name=HiSeq13631|organism=Ostrinia scapulalis|type=polypeptide|length=210bp
LQMTAELVPRYSGRDSTYPVTRWVEDVESNAEIFGWSPLQQLLVARRSLT
GTAQLWLRAERPFKSWDDLKAAITKEFPDTVDVKAIHELMSARKKRVDET
CLDYMLIMKELGKRGKMPDYVAIKYIVDGIVDIETNKMMLYGVTTYSDLK
EKLKIYETIVSKMQKSSVPRNEAESFKQXSKGGKVTGASGVTAVATWVMH
LPTAHTRIKA
back to top