HiSeq1363_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq1363
Unique NameHiSeq1363_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length70
Homology
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930672500|gb|KPJ13083.1| (hypothetical protein RR48_05192 [Papilio machaon])

HSP 1 Score: 69.3218 bits (168), Expect = 4.382e-14
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 0
Query:    6 QVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
             ++P+F TSR GK ++++G++ F  +  S+G K  WTC K   GCRA I T+  ++V+Y  +HNH
Sbjct:   13 DIEPIFTTSRFGKPVIQIGQYRFNKRSDSKGLKSGWTCVKASNGCRATITTVENIIVKYNNDHNH 77          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|509187339|gb|JAA91790.1| (Mod(mdg4)-heS00531, partial [Pararge aegeria])

HSP 1 Score: 63.929 bits (154), Expect = 4.617e-12
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = 0
Query:    2 VGDAQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
            VGDAQV PVF  +  G  ++ VG + F    R +GPK RW C K   GCRA I T+  ++V+    HNH
Sbjct:    1 VGDAQV-PVFGKTSAGNPVIIVGSYRFNKDTRCKGPKIRWRCVKVPFGCRAAIYTVDDIIVKTVNAHNH 68          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|357626934|gb|EHJ76821.1| (hypothetical protein KGM_07746 [Danaus plexippus])

HSP 1 Score: 64.3142 bits (155), Expect = 1.004e-11
Identity = 29/63 (46.03%), Postives = 42/63 (66.67%), Query Frame = 0
Query:    8 KPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
            +PVFV SR GK ++++G + F     S+G K RW CTK   GCRA I+T+ +V+V +  +HNH
Sbjct:   55 QPVFVLSRNGKPVIQLGRYRFNRWSGSRGAKARWICTKDHKGCRAKILTVDEVIVRFNNDHNH 117          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930672498|gb|KPJ13081.1| (hypothetical protein RR48_05190 [Papilio machaon])

HSP 1 Score: 67.781 bits (164), Expect = 1.092e-11
Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 0
Query:    8 KPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKW-DLGCRALIITIGKVLVEYQKEHNH 70
            KP+F TS RG  M+++G ++F + K   GPK+RW C+KW   GCRA I T+  VLV+    H H
Sbjct:  318 KPIFTTSNRGNPMIQMGRYNFSLTKTGGGPKRRWVCSKWGSTGCRATITTLDNVLVKSNLNHMH 381          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930657099|gb|KPI99420.1| (hypothetical protein RR46_03785 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 2.226e-11
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 0
Query:    5 AQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
            A V+ +F TSR GK ++++G + F  +  S+G K  W C K   GCRA I T+  V+V++   HNH
Sbjct:   13 AHVELIFTTSRYGKPVIQLGRYRFNKRSDSKGLKSSWVCVKVSNGCRATITTVEDVIVKFNDNHNH 78          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930672499|gb|KPJ13082.1| (hypothetical protein RR48_05191, partial [Papilio machaon])

HSP 1 Score: 62.003 bits (149), Expect = 8.330e-11
Identity = 28/67 (41.79%), Postives = 40/67 (59.70%), Query Frame = 0
Query:    4 DAQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
            DA  + +F TSR GK +L+ G++ +    RS GPK  W C +   GCRA I TI  ++V+ +  HNH
Sbjct:   50 DATAQLIFTTSRYGKPVLQCGKYRYNRNNRSCGPKVLWVCCRVSSGCRASITTIDNIVVKEKSMHNH 116          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|509163211|gb|JAA79726.1| (modifier of mdg4, partial [Pararge aegeria])

HSP 1 Score: 60.077 bits (144), Expect = 1.736e-10
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 0
Query:    1 AVGDAQ-VKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEH 68
            AVGDAQ   P F T+R G  +L +  + F  +  S+GPK  W C K D  CRA ++T  K ++ Y  +H
Sbjct:    1 AVGDAQGYIPFFSTTRFGNPLLIIDPYRFNKRSDSRGPKISWVCVKKDRQCRATVMTFEKTIIRYNDQH 69          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|509176181|gb|JAA86211.1| (modifier of mdg4, partial [Pararge aegeria])

HSP 1 Score: 60.077 bits (144), Expect = 1.920e-10
Identity = 32/71 (45.07%), Postives = 42/71 (59.15%), Query Frame = 0
Query:    1 AVGDAQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKE-HNH 70
            AVGDAQV P F  +R G  ++  G H +    R +GPK RW C K   GCR ++ITI + +V+   E HNH
Sbjct:    1 AVGDAQV-PQFEETRTGNLVMIFGGHRYNKLTRCRGPKIRWNCVKTPAGCRVVVITIDREIVKILNEPHNH 70          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930681177|gb|KPJ20717.1| (hypothetical protein RR46_00201 [Papilio xuthus])

HSP 1 Score: 60.4622 bits (145), Expect = 5.043e-10
Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 0
Query:    1 AVGDAQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKW-DLGCRALIITIGKVLVEYQKEHNH 70
            A G    +P+F TS RG  M+++G  +F + K   G K+RW C+KW   GCRA I T+  V+++    H H
Sbjct:   63 ASGKDGQQPIFTTSNRGNPMIQIGGCNFSLTKNGGGLKRRWVCSKWGSTGCRATITTLDDVVLKSNLNHMH 133          
BLAST of HiSeq1363 vs. genbank:protein
Match: gi|930657098|gb|KPI99419.1| (hypothetical protein RR46_03784 [Papilio xuthus])

HSP 1 Score: 59.3066 bits (142), Expect = 1.238e-9
Identity = 28/66 (42.42%), Postives = 39/66 (59.09%), Query Frame = 0
Query:    5 AQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGCRALIITIGKVLVEYQKEHNH 70
            A  + VF TSR GK +L+ G++ +    RS GP+  W C +   GCRA I TI  V+V+ +  HNH
Sbjct:   65 ATAQLVFTTSRYGKPVLQCGKYRYNRNNRSYGPRALWVCCRVSSGCRASITTIDDVVVKEKSMHNH 130          
The following BLAST results are available for this feature:
BLAST of HiSeq1363 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|930672500|gb|KPJ13083.1|4.382e-1441.54hypothetical protein RR48_05192 [Papilio machaon][more]
gi|509187339|gb|JAA91790.1|4.617e-1244.93Mod(mdg4)-heS00531, partial [Pararge aegeria][more]
gi|357626934|gb|EHJ76821.1|1.004e-1146.03hypothetical protein KGM_07746 [Danaus plexippus][more]
gi|930672498|gb|KPJ13081.1|1.092e-1146.88hypothetical protein RR48_05190 [Papilio machaon][more]
gi|930657099|gb|KPI99420.1|2.226e-1140.91hypothetical protein RR46_03785 [Papilio xuthus][more]
gi|930672499|gb|KPJ13082.1|8.330e-1141.79hypothetical protein RR48_05191, partial [Papilio ... [more]
gi|509163211|gb|JAA79726.1|1.736e-1040.58modifier of mdg4, partial [Pararge aegeria][more]
gi|509176181|gb|JAA86211.1|1.920e-1045.07modifier of mdg4, partial [Pararge aegeria][more]
gi|930681177|gb|KPJ20717.1|5.043e-1039.44hypothetical protein RR46_00201 [Papilio xuthus][more]
gi|930657098|gb|KPI99419.1|1.238e-942.42hypothetical protein RR46_03784 [Papilio xuthus][more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007588Zinc finger, FLYWCH-typePFAMPF04500FLYWCHcoord: 11..70
e-value: 1.5E-13
score: 50.2

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq1363HiSeq1363Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq1363_p ID=HiSeq1363_p|Name=HiSeq1363|organism=Ostrinia scapulalis|type=polypeptide|length=70bp
AVGDAQVKPVFVTSRRGKTMLRVGEHHFRVKKRSQGPKQRWTCTKWDLGC
RALIITIGKVLVEYQKEHNH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR007588Znf_FLYWCH