HiSeq13644_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13644
Unique NameHiSeq13644_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length405
Homology
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|910311417|ref|XP_013163806.1| (PREDICTED: zinc finger protein OZF-like [Papilio xuthus])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 263/359 (73.26%), Postives = 304/359 (84.68%), Query Frame = 0
Query:   45 AATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            AA +V+ RD  + RR  FR NI IIIES TA PFKYRKGTY+C+YC+ +FLEPE+LREH + QHSDVK  +KP+KYEPLKMDF +TTCKLCG  I DY  LK HL+ EH K +DC+YGDS+LPY L++DE+ CQICGKRYEMFLSLH+HMNEH+  +ICE CGK F T  RM NHARTHERG FPC+ C++TF SYA++  HVAK+HRSN+RYKCPICDEKFASYKHR+KHL+T+HGEK  +FPC  CP+VFDLCSRRTAHIRFQHLQERNH C  C MKFF+ +ELQEHSIKH GERIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC VCGQ+FIQNCSLKQHMRVHHP+  K++ 
Sbjct:    6 AAVIVTGRDAGNERRAAFRNNIKIIIESCTACPFKYRKGTYLCFYCKTSFLEPERLREHTRHQHSDVKQLLKPRKYEPLKMDFALTTCKLCGFSISDYEMLKSHLR-EHGKHLDCSYGDSILPYNLTKDEHRCQICGKRYEMFLSLHKHMNEHYEHFICETCGKRFATSQRMVNHARTHERGDFPCKRCQDTFPSYASLYAHVAKIHRSNKRYKCPICDEKFASYKHRLKHLNTIHGEKTAIFPCPSCPRVFDLCSRRTAHIRFQHLQERNHSCSLCFMKFFTKYELQEHSIKHGGERIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPVCGQAFIQNCSLKQHMRVHHPSQTKSNA 363          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|943953423|ref|XP_014359604.1| (PREDICTED: zinc finger protein 260-like isoform X4 [Papilio machaon])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 259/359 (72.14%), Postives = 305/359 (84.96%), Query Frame = 0
Query:   45 AATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            AA +V+ RD  + RR  FR NI +IIES TA PFKYRKGTY+C++C+ +FLEPE+LREH + QHSDVK  +KP+KYEPLKMDF +TTCKLCG+ I DY  LK HL+ EH K +DC+YGDS+LPY L++D++ CQICGKRYEMFLSLH+HMNEH+  +ICE CGK F T  RM NHARTHERG FPC+ C++TF SYA++  HVAK+HRSN+RYKCPICDEKFASYKHR+KHL+T+HGEK  +FPC  CP+VFDLCSRRTAHIRFQHLQERNH C  C MKFF+ +ELQEHSIKH GERIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC VCGQ+FIQNCSLKQH+RVHH +  K++V
Sbjct:  239 AALVVTGRDAGNERRAAFRNNIKMIIESCTACPFKYRKGTYLCFFCKTSFLEPERLREHTRHQHSDVKQLLKPRKYEPLKMDFALTTCKLCGLSISDYEMLKSHLR-EHGKHLDCSYGDSILPYNLTKDDHRCQICGKRYEMFLSLHKHMNEHYEHFICETCGKRFATSQRMVNHARTHERGDFPCKRCQDTFPSYASLYAHVAKIHRSNKRYKCPICDEKFASYKHRLKHLNTIHGEKTAIFPCPSCPRVFDLCSRRTAHIRFQHLQERNHSCPLCFMKFFTKYELQEHSIKHGGERIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPVCGQAFIQNCSLKQHVRVHHSSQTKSNV 596          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|909558287|ref|XP_013134151.1| (PREDICTED: zinc finger protein OZF-like [Papilio polytes])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 258/359 (71.87%), Postives = 302/359 (84.12%), Query Frame = 0
Query:   45 AATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            AA LV+ RD  + RR  FR NI +IIES TA PFKYRKGTY+C++C+ +FLEPE+LR+H + QHSDVK  +KP+KYEPLKMDF  TTCKLCG+ I DY  LK HL+ +H   +DC+YGDS+LPY L++DE+ CQICGKRYEMFLSLH+HMNEH+  +ICE CGK F T  RM NHARTHERG FPC+ C++TF SYA++  H+AK+HRSN+RYKCPICDEKFASYKHR+KHL+ +HGEK  +FPC  CP+VFDLCSRRTAHIRFQHLQERNH C  C MKFF+ +ELQEHSIKH GERIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC VCGQ+FIQNCSLKQH+RVHHP   K+DV
Sbjct:   10 AAVLVTGRDAGNERRAAFRNNIKLIIESCTACPFKYRKGTYLCFFCKTSFLEPERLRDHTRQQHSDVKQLLKPRKYEPLKMDFAFTTCKLCGLSIADYEMLKSHLR-DHGIHLDCSYGDSILPYNLTKDEHRCQICGKRYEMFLSLHKHMNEHYEHFICETCGKRFATSQRMVNHARTHERGDFPCKRCQDTFPSYASLYAHIAKIHRSNKRYKCPICDEKFASYKHRLKHLNEIHGEKTAIFPCPSCPRVFDLCSRRTAHIRFQHLQERNHSCPLCFMKFFTKYELQEHSIKHGGERIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPVCGQAFIQNCSLKQHIRVHHPNQTKSDV 367          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|930673783|gb|KPJ14216.1| (Zinc finger protein 729 [Papilio machaon])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 257/354 (72.60%), Postives = 302/354 (85.31%), Query Frame = 0
Query:   45 AATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTN 398
            AA +V+ RD  + RR  FR NI +IIES TA PFKYRKGTY+C++C+ +FLEPE+LREH + QHSDVK  +KP+KYEPLKMDF +TTCKLCG+ I DY  LK HL+ EH K +DC+YGDS+LPY L++D++ CQICGKRYEMFLSLH+HMNEH+  +ICE CGK F T  RM NHARTHERG FPC+ C++TF SYA++  HVAK+HRSN+RYKCPICDEKFASYKHR+KHL+T+HGEK  +FPC  CP+VFDLCSRRTAHIRFQHLQERNH C  C MKFF+ +ELQEHSIKH GERIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC VCGQ+FIQNCSLKQH+RVHH ++
Sbjct:    6 AALVVTGRDAGNERRAAFRNNIKMIIESCTACPFKYRKGTYLCFFCKTSFLEPERLREHTRHQHSDVKQLLKPRKYEPLKMDFALTTCKLCGLSISDYEMLKSHLR-EHGKHLDCSYGDSILPYNLTKDDHRCQICGKRYEMFLSLHKHMNEHYEHFICETCGKRFATSQRMVNHARTHERGDFPCKRCQDTFPSYASLYAHVAKIHRSNKRYKCPICDEKFASYKHRLKHLNTIHGEKTAIFPCPSCPRVFDLCSRRTAHIRFQHLQERNHSCPLCFMKFFTKYELQEHSIKHGGERIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPVCGQAFIQNCSLKQHVRVHHSSS 358          

HSP 2 Score: 298.13 bits (762), Expect = 5.217e-88
Identity = 144/329 (43.77%), Postives = 208/329 (63.22%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNC 385
            +KN ++I+E++   PF++ K  ++C+YC   FL+P+ LREHN  +HS   ++       K KK+E +K++ T  +CK+C   + D  +LK HL   H+  I+    D +LP+K+S+D + C +C  ++E F SL+ HMN HF  YICE CG  F+T  R+  H+  H  G FPC  C + F S  A   H+A +H+  +R++CP C E F +Y  R KH+S+VHG  +  F C LCP+VF+L  +   H R  HL+ + + C  C  KF+S  EL+ H IKH GER YQC+VCKK+YAR  TL EHMRIH++DRR+ C  CG+SF+QNC
Sbjct:  392 KKNSTLILEAAKLCPFRWMKNLFICFYCDQQFLDPDALREHNNLEHSTPSLSQIEHEMSKQKKHEFVKVELTNVSCKICNQILHDIPSLKYHLMDRHDMYINS--NDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSELKFHMIKHGGERKYQCNVCKKAYARKYTLTEHMRIHDNDRRYSCGECGRSFVQNC 718          

HSP 3 Score: 203.371 bits (516), Expect = 5.186e-54
Identity = 112/314 (35.67%), Postives = 164/314 (52.23%), Query Frame = 0
Query:   57 RRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQH--SDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDE--YCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIH 366
            ++ I  R+N   + E ST YPF Y    + C+ C   FLE   L+ H +  H  + +K  V  ++   +K+D +   CKLC     D   LK+HLK EH+K I+    D+++P+ L  DE  Y C +C  ++    +L  HM+ HF  Y CE CG  F+T   +  H   HE G F C  C + F +   +  H+  VH      +CPIC E+F S   R KHL  VH +   V  C  C + F+L      H R  HLQERNH C  C  +F +   L+ H + H GE+ Y+C++C +++ R K LR+H+R+H
Sbjct:  801 QKNIDIRQNALTLFEFSTVYPFVYGNNKFKCFICSQPFLETSLLKRHMQDTHTYAPIKRLVNNRRENVIKVDVSEMGCKLCPHKPKDLQELKVHLKVEHHKLIEPDLKDNIIPFVLEGDEEGYKCVMCESKFIKVRTLVIHMSVHFNNYSCEICGSGFMTLRLLKKHLEVHESGNFHCDRCNKVFNTSHKLSLHIRGVHLKQYPRRCPICPERFNSNYRRTKHLQDVHNQSTRVHKCKTCGRGFNLRYHLVCHTRSVHLQERNHQCKICLQRFCNKETLKRHMVIHTGEKNYKCEMCGEAFLRRKNLRDHLRVH 1114          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|768414104|ref|XP_011569200.1| (PREDICTED: zinc finger protein 26-like isoform X7 [Plutella xylostella])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 245/358 (68.44%), Postives = 299/358 (83.52%), Query Frame = 0
Query:   48 LVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDVRI 405
            L + R     RR  +R NI++I++S TA PFKYR+GTY+C+YC NTFLEPEKLREH  T HSDV++T +P+KYEP+K+DF  TTCKLCG  I +Y  LK+HL  EH K +DC++ DSVLPYKL++D +CCQ+CGKRYEMFLSLH+HMNEH+ ++ICE CGK FVT HRM NHARTH+RG FPC+LC ++F +Y+ +  H+A+VH+SN+RYKCPICDEKF SYKHR+ HL  VHG+K+  FPC  CPKVFDLCS+RTAH+RF+HLQERNHVC  CGMKFF+N+ELQEHS+KH GERIYQCDVCKK+YARLKTLRE+MRIHN+DRRFVC VCG SFIQNCSLK HMRVHHPT  K+  ++
Sbjct:  248 LDTDRTEQRERRETYRNNITLILQSCTACPFKYRRGTYLCFYCDNTFLEPEKLREHTSTTHSDVQLTYRPRKYEPVKIDFVNTTCKLCGAYIENYDGLKVHLSLEHGKLLDCSHEDSVLPYKLTKDMFCCQVCGKRYEMFLSLHKHMNEHYERFICETCGKKFVTAHRMVNHARTHQRGCFPCKLCSDSFPTYSNLHAHIARVHKSNKRYKCPICDEKFTSYKHRLNHLRNVHGKKLAGFPCPSCPKVFDLCSQRTAHVRFRHLQERNHVCPVCGMKFFTNYELQEHSVKHGGERIYQCDVCKKAYARLKTLREYMRIHNNDRRFVCLVCGHSFIQNCSLKHHMRVHHPTQFKDLFKL 605          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|357631484|gb|EHJ78957.1| (hypothetical protein KGM_06923 [Danaus plexippus])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 255/385 (66.23%), Postives = 305/385 (79.22%), Query Frame = 0
Query:   20 IVDEGREISTMQAVRQRKFVPTETIA-ATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            +VD  +E+     +    FV  +++A A +V  R   + RR  FRKNI II+ SSTAYPFKY KGTY+C++C N+FLEPEKLREH +  H+D     K KKYEPLKMDF+ + CKLCG  + DY NLK HL+ +H K +D T+G+S+LPYKL++D++CCQICGKRYEMFLSLHRHMN+H+  +ICE CGK F T  R+ NH+RTHER  FPC+ C ET +SYAA+  H+AKVHR N+RYKCPICDEKFASYK+R+KHL+TVHGEK T+FPC  CPKVFDLCSRRTAH+R  HLQERNH C  CGMKFFSN+ELQEHS+KH G RIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC  CG SFIQ CSLKQH+RVHHP  +K D+
Sbjct:  366 VVDIKQEMD----IDMENFVTYDSMARAEIVKRRAEGNERRAAFRKNIKIIMTSSTAYPFKYIKGTYLCFFCENSFLEPEKLREHTQKIHTDR--AFKLKKYEPLKMDFSASICKLCGTGVDDYLNLKAHLR-DHGKILDSTHGESILPYKLTKDDHCCQICGKRYEMFLSLHRHMNDHYEHFICETCGKRFATTQRLLNHSRTHERRDFPCKHCGETSSSYAALYAHIAKVHRLNKRYKCPICDEKFASYKYRIKHLNTVHGEKTTLFPCPSCPKVFDLCSRRTAHVRSHHLQERNHTCSVCGMKFFSNYELQEHSVKHVGARIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPACGASFIQKCSLKQHVRVHHPIQVKTDM 743          

HSP 2 Score: 215.698 bits (548), Expect = 1.286e-59
Identity = 123/355 (34.65%), Postives = 181/355 (50.99%), Query Frame = 0
Query:   15 SGQVPIVDEGREISTMQAVRQRKFVPTETIAATLVSPRDTADRRRILF---RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERG--VFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMR 364
            + ++P   E R   TM        + + T  A     +    RRR  +   R N +IIIE S   PF++++G + C YC +TF     +  H +   S ++     + Y+ +K++ +   C++C   +    +LK HL   H K I    G  V P+ L   E  C  CG+R+ +F  L+ HMNEH+   IC +CGK+F   HRM  H  THE       C  C E F +      H+   H    RY+CP C+  F  Y  R++HL  +HG+ I  +PC LC  VF +  +RT HI+  H++ +   C  C  KF +  +L+ H +KH G R +QC VCKKSYAR +TL+EHMR
Sbjct:    8 NNELPEESEKRIAKTMMRRNALTILESSTAWAFRTVKKVIWKRRRRPYNDHRDNAAIIIEFSNVCPFRWKRGAFACSYCPSTFGHFRDVCTHTREHTSRIEAMRYARPYDNIKIEVSNLKCEICAESLSTLEDLKYHLIDVHQKPILKHLGLGVTPFVLQDKEMLCTHCGERFSLFSKLNSHMNEHYPNNICFHCGKSFTAVHRMKAHQLTHETNDQEHKCSKCNEVFETRVLRNYHMNTKHSPVNRYRCPYCNLSFKRYSDRLRHLKELHGQNIE-YPCHLCSAVFAMSDQRTKHIKNVHIKHKQFQCDFCPSKFVTAGQLKNHMVKHTGIREFQCTVCKKSYARARTLKEHMR 361          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|827547996|ref|XP_012546262.1| (PREDICTED: gastrula zinc finger protein XlCGF26.1-like [Bombyx mori])

HSP 1 Score: 496.123 bits (1276), Expect = 1.164e-172
Identity = 235/382 (61.52%), Postives = 292/382 (76.44%), Query Frame = 0
Query:   21 VDEG-----REISTMQAVRQRKFVPTETIAATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPT 397
            +D+G     R+   +  +R+++       AA     RD  + +R +FR NI+ I+ES TAYPFKYRKGTYMC+YC ++FL+P +LREH   +H + K + KP+KYEPLKMDF    CK+CG D+ DY  L+ H+ TEH K ID ++G+SVLPYKL+ D + CQICGK YE+FL+LH+HMN+H+  +ICE+CGK F T  RM NH+ THE G FPC +C + F SY++   HV KVH++N RYKCPICD KF SYK R+KHL+ VHG+K   FPC  CPKVFDLCSRRTAHIR +HLQERNHVC  CGMKFFS +EL+EHSIKH GERIYQCDVCKK+YARLKTLREHMRIHN++RRF+C VCGQ+F+Q CSLKQHMRVHHPT
Sbjct:    1 MDDGIQMMPRQTEEISLIREKQGASYLAFAAPPTGDRD--ELKREVFRNNIATILESCTAYPFKYRKGTYMCFYCNSSFLDPSELREHTHAEHPNPKPS-KPRKYEPLKMDFANINCKICGQDVEDYATLRAHV-TEHGKVIDLSHGESVLPYKLNGDAHYCQICGKHYEVFLTLHKHMNDHYQLFICEHCGKKFATSQRMVNHSITHETGAFPCNICGKIFNSYSSKYAHVCKVHKANTRYKCPICDVKFVSYKQRLKHLTIVHGQKPATFPCPSCPKVFDLCSRRTAHIRHKHLQERNHVCSVCGMKFFSKYELKEHSIKHGGERIYQCDVCKKAYARLKTLREHMRIHNNERRFICPVCGQTFVQKCSLKQHMRVHHPT 378          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|914573733|gb|KOB76193.1| (Uncharacterized protein OBRU01_06181, partial [Operophtera brumata])

HSP 1 Score: 544.273 bits (1401), Expect = 2.681e-172
Identity = 246/336 (73.21%), Postives = 287/336 (85.42%), Query Frame = 0
Query:   58 RRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRV 393
            RR  FR NIS I+E STAYPFKYRKG Y+C++C++TF+EPEKLREHN+ QH++ K  +KP+KYEPLK+DF  T CK C + I DY   K+HL   H K +DCT+GDSVLPYKL ++E+ CQICGKRYEMFLSLH+HMNEH+  YICE CGK F T  RM NH RTHERGVFPC+ C+E+F SYA++  H+AKVHR N+RYKCPICDEKF SYKHR+KHL+TVHGEK  +FPC +CP+VFDLCS+RTAHIRF+HLQERNH+C  CGMKFF+N+ELQEHSIKH GERIYQCDVCKKSYARLKTLREHMRIHN+DRRFVC VCGQSFIQNCSLKQHMR+
Sbjct: 2034 RRAAFRNNISTILEISTAYPFKYRKGAYLCFFCKSTFIEPEKLREHNRIQHAETKHLLKPRKYEPLKIDFAETVCKECNLGITDYATFKIHLMAAHGKIVDCTWGDSVLPYKLGKEEHSCQICGKRYEMFLSLHKHMNEHYEHYICETCGKRFATAQRMVNHTRTHERGVFPCKRCEESFTSYASVYAHIAKVHRLNKRYKCPICDEKFVSYKHRLKHLNTVHGEKTAIFPCPVCPRVFDLCSQRTAHIRFRHLQERNHICSVCGMKFFTNYELQEHSIKHGGERIYQCDVCKKSYARLKTLREHMRIHNNDRRFVCPVCGQSFIQNCSLKQHMRI 2369          

HSP 2 Score: 433.721 bits (1114), Expect = 9.191e-134
Identity = 199/319 (62.38%), Postives = 245/319 (76.80%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSF 381
            R NI+ I+ +STAYPFKYR G Y+CY+C  TF+EPE+LR+H +T HS     VKP + + LKMDF   +CKLC   I DY   K+HLK EH   +D T+G+SVLPYKL+++E+ CQ+CGKRYE+FLSLH+HMNEHF  YICE CGK F T  RM  HARTH RGVFPCR C+ETF S +A+  HV+KVHR N+RYKCPIC+EKF SYKHR+KHLS+VHG+   +FPC  C KVF LCS+R+AH+R QHLQERNH+C ECGMKFF   EL+ HS+KH G RI++C VCKK+Y+R  TL+EHMRIHN+DRRF+C  C    
Sbjct: 1711 RSNIATILRTSTAYPFKYRNGAYLCYFCSTTFIEPERLRDHFRTAHSQSNKPVKPSRCDFLKMDFADISCKLCNAKIYDYAAFKIHLK-EHENGLDFTWGESVLPYKLNKEEHTCQVCGKRYELFLSLHKHMNEHFEHYICETCGKRFATSQRMLTHARTHVRGVFPCRRCEETFESSSALYNHVSKVHRMNKRYKCPICNEKFVSYKHRLKHLSSVHGQNTAIFPCPSCTKVFTLCSQRSAHVRCQHLQERNHICQECGMKFFKKCELKMHSVKHGGARIFECVVCKKAYSRAHTLKEHMRIHNNDRRFICTYCNSGL 2028          

HSP 3 Score: 288.115 bits (736), Expect = 3.627e-83
Identity = 154/376 (40.96%), Postives = 222/376 (59.04%), Query Frame = 0
Query:   40 PTETIAATLVSPRDTADRRRILFRKN----ISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVK------ITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDVRI 405
            P ET A   V  R     + IL +++    + +++E S    FK +  +++C YC   +++P KLREHN  +H DVK         +  K E LK D T  +CKLC   I    +L  HL  +HNK ID      +LPYK++ D+Y C ICG+++  + +L+ HMN H+ +++CE CG  FVT  R+ +H  THE G FPC  C + F S  AM  H A +H   +++ CP C EKF++Y  R+KHLS+VHG  +  + C  C +VF+      +HIR  HL+E++H C EC   FFS   L++H +KH+GE+ +QC VC K++ R  TL +HMRIH +DRRFVC VC  SF+Q CSLKQH  +    + K+ V +
Sbjct: 3559 PDETQAD--VVTRHDKKAQAILAKRDRLQRVLVLLECSRICLFKRKASSFICIYCDQGYVDPAKLREHN-IEHEDVKPVDIKKAIARIDKPELLKADITDVSCKLCNTSIDRLDDLVKHLFEKHNKKIDLNAEIGILPYKMNLDDYICAICGEKFTDYKTLNHHMNLHYPRFVCEQCGSGFVTAMRLKSHVVTHETGSFPCNACDKVFNSKDAMKGHFAYLHMKVKKHSCPQCHEKFSNYFQRLKHLSSVHGMDLDEYKCNFCTRVFNAKGPLRSHIRASHLKEKSHACDECDATFFSKSCLRKHVVKHSGEKKHQCCVCLKAFGRKSTLVQHMRIHLNDRRFVCNVCEASFVQKCSLKQHEDILTRNDTKSQVTL 3931          

HSP 4 Score: 278.485 bits (711), Expect = 7.032e-80
Identity = 142/328 (43.29%), Postives = 198/328 (60.37%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKP--------KKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFI 382
            R+ + I++E S   PFK+ +  Y C +C   +++P KLREH  T H D+K+            KK+E +K D T  +CKLC   I    +L  HL  +H K ID      +LP+K++ D+Y C IC K+Y  + SL+ HMN H+  +ICE CG  F+T  R+  H  THE G  PC  C + F S  A   H A +H   +R++CP C E F +Y  R KH+S +HG K   F C LCPKVF +  +   H+R+ HL+ + + C  C  KF+S+ EL++H + H+GER YQC+VCKKSYAR  TLREHMRIH++DRRFVC +CG+  +
Sbjct: 5317 RQRVLILLECSRICPFKWIRNLYFCIHCDQKYVDPAKLREH-YTVHEDIKLAEIKHAISQHHRKKHEFVKADITDVSCKLCDTPINRLDDLLTHLFEKHQKKIDPKSDVGILPFKINLDDYKCVICDKKYGEYKSLNHHMNVHYQNFICELCGSGFITPERLRVHCFTHETGSIPCEACDKVFRSKNAKKEHYAYIHMKVKRHRCPQCPETFRNYFQRSKHISLIHGMKTKEFKCDLCPKVFTVSGKLRVHVRYAHLKLKRYACEVCEWKFYSSSELKQHMVTHSGERKYQCNVCKKSYARKYTLREHMRIHDNDRRFVCTICGKMVV 5643          

HSP 5 Score: 249.595 bits (636), Expect = 8.217e-70
Identity = 127/334 (38.02%), Postives = 184/334 (55.09%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQH 390
            ++ +  ++ SS   PFK++   + C YC   + +P KL+EHN+  H D+K+          K  + +K D T  +CKLC   I  +  LK HL   H    +    D +LP+KL    + C  C + +  + +L  H+  HF  Y CE CG  FV++  +  H  THE G FPC  C + F +  +   H   VH   +  +CP C E F  Y  ++ H+S VHG KI  F C +CP VF++  R   HIR  HL+E+ + C +C  KF S   ++ H + H G + Y+C+VC+K+Y R  TLR+HMRIH DDRRFVC +C +SF+Q CSLK H
Sbjct: 3037 KERVMKLLMSSRICPFKWKSNIFYCIYCNEQYSDPVKLKEHNQV-HGDLKLAEIQRALTNLKTLDLVKADITDVSCKLCDAMIDTFDVLKHHLVNTHEHNSNLISDDGILPFKLEPGSFKCGSCDEGFPEYRTLFYHLKTHFQNYTCEQCGTGFVSESGLRRHFATHETGSFPCNECDKVFRTKQSKLLHEKIVHLKAKTNRCPYCFESFLYYDQKLNHISAVHGIKIKQFTCDMCPSVFNIRGRLYRHIRTTHLKEKRYACDDCDAKFSSKSGVRNHMLMHTGVKKYKCEVCQKAYGRQFTLRQHMRIHLDDRRFVCNICEKSFVQKCSLKNH 3369          

HSP 6 Score: 240.35 bits (612), Expect = 1.366e-66
Identity = 139/365 (38.08%), Postives = 196/365 (53.70%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRD-EYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTH---ERGVFPCRLCKETFASYAAMCTHVAKVHRSN--QRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRR---------------------FVCFVCGQSFIQNCSLKQHMRVHHPTNMK 400
            R N +II+E S   PF++++G ++C YC  TF E   LREH   +H +    ++      LK D T   C+LC   I D   L  HLK  H K +    G  V+PY L  D +Y C  C   +++F +L+ HMN+H+   +C  CGK F   ++M  H +TH    +G + C  C E F S      H      S+   RY+CP C+E F SY +R+KHL   H  KI  +PC+LC  VF + ++RT HIR  H++++   C  C  +F + H+LQ H I HNGER Y+C VCKKSY+R+ TLREHMRIHN+DRR                     ++C+ C  +FI+   L+ H R  H  + K
Sbjct: 1399 RDNAAIILECSNVCPFRWQRGLFVCAYCSLTFAEFGPLREH-VIEHPNKIEALRIVGKHILKGDITDLKCELCLASIKDLNALVEHLKNAHQKPLINVLGLGVIPYLLISDGDYQCTHCTDTFKLFTTLNNHMNDHYPNSVCPLCGKAFSDSNKMTAHMKTHGIGAKGQYKCSKCDEVFPSAYDRHKHAMSSKHSSTMMRYRCPHCNENFKSYSNRLKHLKDFHDSKIE-YPCSLCSAVFRMTNQRTKHIRQVHIKDKRFNCTVCPYQFVTAHQLQRHMICHNGERKYECQVCKKSYSRVSTLREHMRIHNNDRRSNIATILRTSTAYPFKYRNGAYLCYFCSTTFIEPERLRDHFRTAHSQSNK 1761          

HSP 7 Score: 236.113 bits (601), Expect = 3.900e-65
Identity = 120/328 (36.59%), Postives = 178/328 (54.27%), Query Frame = 0
Query:   69 IIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVK------ITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQH 390
            ++ SS   PFK++   + C YC   + +P KL+EHN+  H D+K           K    +K D +  +CKLC   I  + +LK HL  +H         D VLP+ L    + C  C + +  + +L  H+  HF  Y CE CG  FV++  +  H  THE G F C  C + F +  +   H   VH   +R +CP C E F  Y  ++ H++T HG  +  F C +CP VF++  +  +HIR  HL+E+ + C +C   F +   ++ H + H G + Y+C+VC+K+Y R  TLR+H+RIH DDRRFVC VC +SF+Q CSLK H
Sbjct: 2703 LLMSSRICPFKWKSNIFYCIYCNEQYSDPVKLKEHNQV-HGDLKQAEIQRALTNLKTLGLVKADISDISCKLCDAMIDTFDDLKNHLVNKHEHNSKLISDDGVLPFILDPGSFKCGSCDEGFPEYRTLTHHLKTHFQNYTCEQCGTGFVSESALRRHFGTHETGSFSCNECDKVFRTKESKLHHEKIVHLKAKRNRCPYCLETFLYYFQKLNHIATAHGIIVKQFTCDMCPSVFNIRGKLNSHIRTTHLKEKRYACDDCDANFSAKSGVRNHMLTHTGVKKYKCEVCQKAYGRQSTLRQHIRIHLDDRRFVCNVCEKSFVQKCSLKHH 3029          

HSP 8 Score: 234.958 bits (598), Expect = 8.152e-65
Identity = 119/291 (40.89%), Postives = 168/291 (57.73%), Query Frame = 0
Query:   71 ESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVK------ITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYAR 355
            E ST   FK +   +MC YC  ++ +P KLREH  T H DVK         +    E +K D T  +CK C + I    NL  HL  +HNK ID      +LP+K++ D Y C IC   Y  F +L+ HMN H+ +Y+CE CG  FVT  R+  H  +HE G FPC  C + F S  AM  H    H   +++ CP C EKF ++  R+KHL+++HG K+  F C  C KVF+L  R ++H+R  HL+E++H+C+ C  KFF    L++H + H+GE+ YQC +C+K+Y R
Sbjct: 4427 ECSTISLFKQKGTLFMCIYCNKSYADPAKLREH-YTAHRDVKPAETGRAIARMNTTELIKADLTDISCKFCDIPIDRLDNLITHLYEKHNKKIDPNLDIGILPFKINLDNYKCAICDGNYTDFKTLNHHMNVHYPKYVCEKCGSGFVTAMRLKKHVVSHETGSFPCSACDKVFGSKDAMKGHYEYGHMKLKKHSCPQCPEKFLNHSQRLKHLTSIHGAKLKEFKCNFCSKVFNLRGRLSSHVRATHLKEKHHLCNLCDAKFFGKACLRKHMLMHSGEKKYQCGLCQKAYGR 4716          

HSP 9 Score: 217.624 bits (553), Expect = 9.553e-59
Identity = 118/354 (33.33%), Postives = 179/354 (50.56%), Query Frame = 0
Query:   69 IIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRR----------------------FVCFVCGQSFIQNCSLKQHMRVH 394
            ++ SS   PFK++   + C YC     +P KLR HN+  H ++K+          K  + +K D T  +CKLC V I  + +LK+HL  +H    +    D +LP+KL    + C  C + +  +++L  H+  HF  Y CE CG  +V++  +  H  +H+ G FPC  C + F +      H   VH   +R +CP C E F  Y  ++ H++T HG  +  F C +CP VF++     +HIR  HL+E+ H C  C  KF S   +++H + H G + Y+C VC+K+Y R  TLR+HMRIH DDRR                      F C  C + +     LK+H +VH
Sbjct: 2389 LLLSSRICPFKWKNSIFCCIYCNEQCSDPVKLRYHNQV-HGNLKLAEIRRALTNLKANDLVKADITDVSCKLCDVTIVRFDDLKIHLVNKHKLNSNLISHDRILPFKLDTGSFKCGTCDEGFPEYMTLFHHLKTHFQNYTCEQCGTGYVSRIALQRHVASHQTGSFPCNECDKVFRTQQYKHNHEKMVHLKVKRNRCPYCLETFLYYVQKLNHIATAHGIIVKQFRCDMCPSVFNVKGELNSHIRTIHLKEKRHACDVCDAKFSSKSGVRKHMLMHTGVKKYKCGVCQKAYGRHFTLRQHMRIHLDDRRFERVMKLLMSSRICPFKWKSNIFYCIYCNEQYSDPVKLKEHNQVH 2741          

HSP 10 Score: 216.083 bits (549), Expect = 2.630e-58
Identity = 117/297 (39.39%), Postives = 161/297 (54.21%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPK------KYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYK-CPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKS 352
            RK+I +++E S  + FK +   +MC YC   + +P KLREHN  +H DVK     K      K E  K D T  +CKLC   I    +L  HL  +HNK ID      +LP+K++ D+Y C +C ++Y  + +L  HMN H+ +++CE CG  F T  R+  H   HE G FPC  C + F S  A   H    H    + + CP C EKF++   R+ HLST+HG K+    C  C KVF+L  R T H+R  HL+E+ H C  C  +FF   EL  H  KH GE+ +QC  C K+
Sbjct: 4109 RKHILVLLECSRIFLFKQKGVLFMCIYCDKKYKDPAKLREHN-IEHEDVKPFQMKKAIAAMHKTELYKADVTDVSCKLCDFPIYRLDDLLTHLIKKHNKEIDLNTDIGILPFKINLDDYKCAVCDEKYIDYNTLSHHMNVHYPRFVCEQCGSGFATAMRLKAHVLRHETGSFPCDACHKVFGSKNARNAHYVYTHIKKGKTRCCPQCPEKFSNVVQRLNHLSTIHGMKMKELKCNFCSKVFNLKGRLTLHVRSMHLKEKRHACDVCDAQFFGKSELTRHMCKHTGEKKHQCGFCHKA 4404          

HSP 11 Score: 212.616 bits (540), Expect = 5.081e-57
Identity = 116/321 (36.14%), Postives = 165/321 (51.40%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARL---------KTLREHMRIHND 368
            R+ I I++E S    FK +    +C YC   + +P K R+HN  +H DVK         +    +  K D T  +CKLC   I    +L  HL  +H+K I       +LP+K++ D+Y C IC +++  + +L+ HMN H+  ++CE CG  FVT  R+  H  THE G FPC  C + F+S  AM  H   VH   +++ CP C E F  Y  ++KH+++VHG  +  F C  CPKVF        H+R  HL+E+ H C  C   F+    L +H + H GER + C VC+KSY R            LREH   H D
Sbjct: 4732 RQRILILLECSRICLFKRKGSLCICIYCNQGYEDPAKFRKHN-LEHEDVKTVDIARAIARMHTTDLFKADITDVSCKLCDTSIDKLDDLIKHLLEKHDKKIGPNPDIGILPFKMNLDDYKCAICDEKFTDYKTLNHHMNVHYPNFVCEQCGSGFVTAMRLKAHVVTHETGSFPCNACDKVFSSTDAMKGHYEYVHMKVKKHSCPQCSETFLLYYQKLKHITSVHGTNLEKFSCNYCPKVFIARGHLGRHVRETHLKEKRHACSVCDANFYGKSGLTKHMVTHTGERKHHCTVCQKSYGRKTHLNGYVDPAKLREHNTEHED 5051          

HSP 12 Score: 202.601 bits (514), Expect = 1.454e-53
Identity = 118/330 (35.76%), Postives = 168/330 (50.91%), Query Frame = 0
Query:   92 NTFLEPEKLREHNKTQHSDVK------ITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRR---------------------FVCFVCGQSFIQNCSLKQHMRVH 394
            N +++P KLREHN T+H DVK         +    E LK+D T  +CKLC   I    +L  HL  +H K I+      ++P+K + ++Y C IC KRY  +++L  HMN H+  +ICE CG  FVT  R+  H+ +HE G   C  C + F S  A   H   VH   +R+ CP C E F  Y  R+KH+S++HG K+  F C LC KVF    +  AH+R  HL+E+ + C  C  KFFS   L+ H + H+GER YQC    K+  + +   +H  I  + RR                     + C  C Q ++    L++H  VH
Sbjct: 5034 NGYVDPAKLREHN-TEHEDVKPAEIKRAITRINATELLKVDITDVSCKLCDTPIDKLDDLITHLIEKHKKKIEPKSDMGIIPFKFTLEDYKCTICDKRYAEYITLKHHMNIHYPNFICEQCGSGFVTAGRLRVHSFSHETGSIACDSCDKIFRSNNAKRMHNESVHMKLKRHSCPQCPETFLHYYQRLKHISSIHGMKLKEFKCDLCAKVFIASGKLYAHVRATHLKEKRYACDVCNTKFFSTTLLKNHMLSHSGERKYQCGNDTKA-KKPQIQNKHSDIDIEARRQRVLILLECSRICPFKWIRNLYFCIHCDQKYVDPAKLREHYTVH 5361          

HSP 13 Score: 189.504 bits (480), Expect = 4.567e-49
Identity = 100/294 (34.01%), Postives = 154/294 (52.38%), Query Frame = 0
Query:   52 RDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNK---TQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHV-CHECGMKFFSNHELQEHSIKHNGE 341
            R      RI  ++N + I++  T  PF+++K  + C YC + F E   LR+H +   TQH+   I  K K+   + +D T   C +C     D   ++ H+  +H   +D  + D VLP+ L ++ + C IC +++  FL L+ HMN H+  YIC  CGK ++T  R+  H+  H  G F C  C   F   AA  +H A  H    RY+CP C  +F SY HR+ HL   H EK  V+ CA C   F    +R +H+R  H   ++ + C  CG +F +N+EL+ H ++H G+
Sbjct:  511 RSARAEARIAIKRNATSILQCWTLSPFRWKKNKFKCAYCEDHFTECNALRDHIRLCATQHNIKDIYNKFKEMPLINVDSTEAICSVCSTPFIDVAQMREHV-IQHGFELDTKHPDGVLPFYLDKESWKCVICEEKFNNFLKLYEHMNVHYQHYICATCGKGYMTAPRLRKHSEVHISGSFSCTDCDRVFVMRAARDSHKATAHAKGSRYECPHCYIRFDSYYHRMAHLKEAHCEKEVVYNCAHCDMTFKTSGKRASHVRSVHFPVQHDINCSYCGWQFKTNYELKRHMVRHTGD 803          

HSP 14 Score: 189.119 bits (479), Expect = 5.630e-49
Identity = 110/320 (34.38%), Postives = 156/320 (48.75%), Query Frame = 0
Query:   56 DRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDV---KITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDC-TYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRR 371
            D +  L+  N + I E S  YPF Y    Y C+ C   FL+   L++H    +      K+         LK+D T   C++C         LK+HL   H K I+  T  D+++P++L  + + CQICG  Y     L  HM++HF  + CE CG  F+++  +  H   HE G FPC  C + F++      H+  VH  +   +CPIC E+F S   R KHL  VHG    +  C  C K +DL  +   HIR  H QE+N  C  C  +FFS + L  H + H G R Y+C VC K+Y R   L +H + H    R
Sbjct: 6115 DVKHQLWLGNAAKIFELSYVYPFIYTNNKYKCFICLEPFLDANILKQHTMDHNQKEMREKLLYNTANNAILKVDVTHLQCRVCDKIFHSLQELKIHL-INHAKDIEADTTQDNIIPFRLGYEPFQCQICGDEYLKLRQLIIHMSKHFNNFSCEVCGSVFISKKSLRRHLEIHETGTFPCEKCDKVFSNSTKKALHIRGVHLKHFPRRCPICPERFNSDYMRTKHLRMVHGRTTALNKCMACGKEYDLKYQLQLHIRSVHYQEKNQECPVCHSRFFSKYLLSRHMVIHTGIRNYKCGVCGKAYVRKAHLDQHSKSHRSRGR 6433          

HSP 15 Score: 177.948 bits (450), Expect = 4.153e-45
Identity = 118/401 (29.43%), Postives = 193/401 (48.13%), Query Frame = 0
Query:   57 RRRILFRK-NISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKI--TVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCS--------------RRTAHIRFQ-------HLQERNHVCHECGMKFFSNHELQEHSIKHN---------GERI-------YQCDVCKKSYARLKTLREHMR------------------IHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNM 399
            +R++L  K N ++II+ + A  F++++G +MC YC        +LR H+ ++H+ + I  T K +   PL +D +   C +C V I    +LK HL  +H  TI+ ++ D V+P++L+  E+ C  C  R++ F++L  HMN+H+  ++C++CGK +  ++++ +H   HE G F C  C   F++  A   H+++ HR   RY+CPICDE   SY  R+ HL  VHGE  + + C  CP VF+  S              R  A I  +         Q    VC  C + F     L+EH I+H          G+ I        +C++C  S   L  L EH++                  +   D  + C  C  +F    +L  HM  H+P ++
Sbjct: 1140 KRKLLEDKANAALIIKHTNAVVFRWQRGKFMCAYCPKICANFTELRSHS-SEHNKLDIFETSKTRLLFPLNIDISNLVCSICNVFINGIDDLKTHLNDDHAITINPSHSDGVIPFRLTGQEFRCVRCESRFDKFMTLFIHMNKHYPSFVCDSCGKAYSAENKLRSHKAIHESGRFECTQCDLVFSNRIAKNRHISEKHRPKDRYRCPICDEHLNSYHSRLLHLKMVHGES-SEYRCTYCPAVFNSGSSNFKWIPKRKFHDHRDNAAIILECSNVCPFRWQRGLFVCAYCSLTFAEFGPLREHVIEHPNKIEALRIVGKHILKGDITDLKCELCLASIKDLNALVEHLKNAHQKPLINVLGLGVIPYLLISDGDYQCTHCTDTFKLFTTLNNHMNDHYPNSV 1538          

HSP 16 Score: 177.178 bits (448), Expect = 6.367e-45
Identity = 98/282 (34.75%), Postives = 147/282 (52.13%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREH-NKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKL---SRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNG 340
            R+N  I+ E+STAYPF +   ++ C+ C  ++L+   L+ H ++   + +K  V  +K   LK+D +  TCKLC + + D  +LK HL+  H+K ID    D+++PY L   S + Y C +C + +     L  HM++HF  Y CE CG  F+T   +  H   HE G FPC  C++ F++      HV  VH      +CP+C E+F S   R  HL   H +   V  C  C + F L     +H+R  HLQERN  C  C  +F +   L+ H + H G
Sbjct: 5724 RQNALIVFENSTAYPFIFSNNSFRCFVCSQSYLDVPNLKLHMSEHPFAHIKRLVNNRKENVLKVDVSDLTCKLCLLPLRDLVSLKRHLREAHDKAIDTELQDNLIPYDLTIHSNEGYQCVVCEQNFIKVRILVIHMSDHFSNYSCEVCGSGFMTLRLLKKHLEVHETGNFPCDRCEKVFSTTHKRALHVRGVHLKQYPRRCPMCPERFNSNYKRTIHLQDAHNQSTRVHKCKTCGRGFHLKYHLISHVRSVHLQERNQQCDVCLQRFCNKESLKRHMVIHTG 6005          

HSP 17 Score: 174.866 bits (442), Expect = 4.412e-44
Identity = 113/397 (28.46%), Postives = 181/397 (45.59%), Query Frame = 0
Query:   15 SGQVPIVDEGREISTMQAVRQRKFVPTETIAATLVSPRDTADR-RRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSD----VKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHART------HERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEK--------ITVFPCALCPKVFDLCSRRTAHIRFQHLQE---RNHVCHECGMKFFSNHEL---------------QEHSIKHNGERIYQ-------CDVCKKSYARLKTLREHMRIHN 367
            +G + +   GR +   + V +R+          L  P ++  R  + + R+N + ++E STA+ F++  G + C YC   F++ + LREH ++ H +     ++  K ++   +K+D     C+LC + +   + LK HL++ H   +   Y D VLP+KL    + CQ+C   +  F  ++ HMN H+  Y+C+ CGK FV+  R   HA +       E+  F C +C + F S A   +H  KVHR   RY CP C E F SY+ R  HL   H ++        +  + C +C K F   S+R+AH R  H       +H C+ C   F +  +L                   IKH    +++       C  C K  A    LR H   HN
Sbjct:  801 TGDISVAKNGRRLK--ENVSERQMRRRRRACNQL--PEESEKRILKTMMRRNATTLLECSTAWAFRWFHGAFYCAYCDIKFVDTQPLREHVRSNHLNEPPSQRVFSKLQENNMVKIDIAQLQCRLCDISLGSISYLKTHLES-HGVFVQNNYSDGVLPFKLDDGGFFCQLCTSHFLTFTKINEHMNTHYQNYVCDTCGKGFVSTSRFRAHAHSVFNVYLPEKRSFTCGICDDVFCSKALRTSHRLKVHRKGIRYNCPRCSEVFTSYRARSNHLVNFHAQQSKERRSQILQTYVCNICDKSFSTSSKRSAHCRLVHNSPPRLESHQCYYCSALFANKSKLIVWKRKRKLLEDKANAALIIKHTNAVVFRWQRGKFMCAYCPKICANFTELRSHSSEHN 1192          

HSP 18 Score: 174.096 bits (440), Expect = 7.226e-44
Identity = 108/345 (31.30%), Postives = 165/345 (47.83%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKP----KKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDE--YCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHR-SNQR----YKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHP 396
            R+N +  +E +T  PF Y++  Y C+YC   F E   + +H  T ++  +  +      K    +K+D +   C+LC     D  +++ HL   HNK  + + G+ ++ Y LS       C  C K +  F  L++HMN HF   +CE CG  F++  R+ NH   H+ GV  C  C+E F +   +  H  K H  +N +     KCP C E+F+ +  ++ HL  +HG     F C +C  V       T H    H Q     C  CG  F +   L+ H   H GER + C +C+K+Y   KTLR+HM +H    +F+C  CG  F       +HM+  HP
Sbjct: 6444 RQNAATFLECTTVKPFFYQQANYKCFYCNELFPEVHSVLQHTGTHNTPERTCLLKEFLRKGKRVIKVDISGLACRLCHQKYSDLDDIRKHLTAAHNKEFN-SAGNGLMAYDLSSTNGMLSCHKCAKSFNSFFLLNQHMNVHFS-VVCETCGLGFMSHQRLVNHKIVHQIGVHKCDKCQEVFPNKLKLRYHTFKKHEVTNMKKIKPLKCPHCLERFSEHYRKMTHLKQIHGISFN-FDCQVCKAVLPTRRALTEHTTKLHTQRIQ--CKICGKCFGTRSLLKMHMRGHTGERNFFCTICEKAYMHAKTLRQHMSVHGSVLKFMCSECGSGFQNRNDFNKHMKQWHP 6783          

HSP 19 Score: 134.035 bits (336), Expect = 3.776e-30
Identity = 97/378 (25.66%), Postives = 159/378 (42.06%), Query Frame = 0
Query:   58 RRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITV------KPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANH-------------ARTHERGVFPCRLCKETFASYAAM--CTHVAKVHRSNQRYKCPICDEKFAS----YKHRVKHLST----------------VHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVH 394
            +R   ++   +++++S   PFK++K T+MC YC   + +P +LR+HN+  H D+K++       +    + +K D T  +CKLC   I  +  LK HL  +H ++ +      +LP+KL    Y C IC + +  +++L RH N+HF  YICE CG  F +Q R+  H                H++        ++       +  C+ +    R    + C  CD+ +       +H ++H                   +    IT   C LC    D       H+  +H             K   N E+     K N +  Y C +C + +   KTL  HM +H    RFVC  CG  F+    LK H+  H
Sbjct: 3386 KRFTRKEGAMVLLQNSRICPFKWKKNTFMCLYCDEPYADPAELRKHNRDMHDDLKLSEISCALNEIANNDLVKADTTDVSCKLCDATIDKFNYLKNHLVYKHKQSSNLIKDAGILPFKLQHGSYKCGICFEEFTKYMNLSRHFNKHFQNYICELCGAGFASQPRLRTHYSIDDPDETQADVVTRHDKKAQAILAKRDRLQRVLVLLECSRICLFKRKASSFICIYCDQGYVDPAKLREHNIEHEDVKPVDIKKAIARIDKPELLKADITDVSCKLCNTSIDRLDDLVKHLFEKH-----------NKKIDLNAEIGILPYKMNLDD-YICAICGEKFTDYKTLNHHMNLHYP--RFVCEQCGSGFVTAMRLKSHVVTH 3749          

HSP 20 Score: 131.339 bits (329), Expect = 2.741e-29
Identity = 106/399 (26.57%), Postives = 167/399 (41.85%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITV---KPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKL-SRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDE--KFASYKHRVKHLSTVHGEK--ITVFPCALCPKVFDLCSRRTAHIRFQH---------------------LQERNHVCHECGMKFFSNHELQEH---SIKHNGERIYQCDV---------------CKKSYARLKTLREHMRI----HN----------------DDRRFVCFVCGQSFIQNCSLKQHMRVH 394
            R+N  II++ STA PF+     + C +CR    +P  LR H  T+H+D  I     +  + E LK+D T   CKLC   I    +L +HLK++H + I       VLP+KL     + C IC  ++  F+SL +H +EH+  Y+C+ CG+ F+T   +  H R      + C  C  TF++      H+ K   +   Y C  C E  +FA+++ R +HL   H  K    ++ C  C   F   S++  H    H                     +++ ++VC E   K       +     +IK N   I QC                 C+  +     LR+H+R+    HN                D    +C VC   FI    +++H+  H
Sbjct:  217 RRNTEIILQCSTACPFRTWGQNFNCIFCRVQSNDPNGLRAHMATRHADFDIGQVFNRKLRKEFLKVDITDLQCKLCFKRIDSIDDLMVHLKSDHKQPISTDVQPGVLPFKLKDGSSWQCAICTIQFSDFISLKKHTSEHYQNYVCDTCGEGFITDTALIAHTRIPHDNKYACGRCVATFSTLEERSIHI-KTQHTTLPYMCIYCKENPRFATWELRKRHLMEFHNYKPGADMYECTTCHMTFKTRSQKYHHNVKAHRTKKEAEYRRRGLISNKALIKVEDTDNVCVEVKPKSKYQRSARAEARIAIKRNATSILQCWTLSPFRWKKNKFKCAYCEDHFTECNALRDHIRLCATQHNIKDIYNKFKEMPLINVDSTEAICSVCSTPFIDVAQMREHVIQH 614          

HSP 21 Score: 128.642 bits (322), Expect = 2.060e-28
Identity = 102/364 (28.02%), Postives = 151/364 (41.48%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPK------KYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERI-----------------YQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            RK+I +++E S  + FK +   +MC YC   + +P KLREHN  +H DVK     K      K E  K D T  +CKLC   I    +L  HL  +HNK ID      +LP+K++ D+Y C +C ++Y  + +L  HMN H+ +++CE CG  F T  R+  H +     V      K         C+ +    +    + C  CD+K+       +H   +  E +  F                A +        +  C  C    +   +L  H IK + + I                 Y+C VC + Y    TL  HM +H    RFVC  CG  F     LK H+  H   +   D 
Sbjct: 3937 RKHILVLLECSRIFLFKQKGVLFMCIYCDKKYKDPAKLREHN-IEHEDVKPFQMKKAIAAMHKTELYKADVTDVSCKLCDFPIYRLDDLLTHLIKKHNKEIDLNTDIGILPFKINLDDYKCAVCDEKYIDYNTLSHHMNVHYPRFVCEQCGSGFATAMRLKAHTQ-----VTLDNHAKRKHILVLLECSRIFLFKQKGVLFMCIYCDKKYKDPAKLREH--NIEHEDVKPFQMKKAIAAMHKTELYKADV-------TDVSCKLCDFPIYRLDDLLTHLIKKHNKEIDLNTDIGILPFKINLDDYKCAVCDEKYIDYNTLSHHMNVHYP--RFVCEQCGSGFATAMRLKAHVLRHETGSFPCDA 4283          

HSP 22 Score: 124.02 bits (310), Expect = 7.314e-27
Identity = 88/321 (27.41%), Postives = 145/321 (45.17%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKITVKPKKY----EPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPY--KLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHAR-THERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRY---KCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFV 373
            R N +  I+ +T  PF +   ++ C++C   + E   L EH  T  ++ + ++  K        L+ D +   C++C V   +   +K HL+  H      T  + +  Y  KL    + CQ+C K +  F  L++HMN H G+ ICE CG  F+ QH +  H + +H    F C+LC   F   + +  H  ++H+  QR    KCP C + F  +  ++ HL   HG            K F+                    CH C +KF     L EH  K + E+ ++C+VC K Y+    L++H+R H  ++ F+
Sbjct: 6792 RNNAATFIQHTTVRPFIFMGSSFKCFFCLQYYSEIPALLEHTATHTTENEASILNKYLHKGKRTLQADISKLNCRICNVKFSNLDTIKEHLQAAHAICF-FTVSNGITEYNLKLKNKMFVCQLCNKSFHNFSLLNKHMNCHVGKVICEKCGDRFLNQHLLMKHYKESHLYKHFSCKLCDRYFTKRSQLKYHT-QIHKGKQRTNLNKCPECLKTFKQHYGKMLHLKEAHG----------VTKSFE--------------------CHLCELKFSMRRSLTEHVSKDHTEK-HKCEVCSKCYSTEFRLKQHIRGHTSEKNFI 7079          

HSP 23 Score: 108.227 bits (269), Expect = 1.690e-21
Identity = 96/413 (23.24%), Postives = 161/413 (38.98%), Query Frame = 0
Query:    9 FLFLGKSGQVPIVDEGREISTMQAVRQRKFVPTETIAATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKI-TVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDE-YCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHE------RGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGE------------------KITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHH 395
            F FLG+  ++  +++G++       RQ    P                       KN  ++++ STA PFK      +C YC+  F     LR+H K+ HS+    +   K  + LK+D +   CK+C  DI D  +L  H+   H+  ++      VLPY+ S    + C  C K Y  F  ++ H+  H   Y C+ C   F++ H +  H R+ +      +  F   L           C+         Q + C  C  +         H++T H +                   IT   C LC K  D       H++  H Q  +       + F    +L++ S        +QC +C   ++   +L++H   H  +  +VC  CG+ FI + +L  H R+ H
Sbjct:    4 FSFLGRRKEIDELEKGKKPKKRLFERQVNQNPQ---------------------WKNAVLVLKHSTAIPFKTCFNRILCSYCQEEFEPMAALRDHIKSVHSNADFNSAFYKVIDGLKVDISQMQCKICSADITDVDSLMAHISKTHDIPVNFEVSFGVLPYRQSSTALWMCLYCDKTYIKFSQINEHLRSHVKIYTCDKCSATFLSIHGLRQHERSFKCYKMNYKPRFGKTLKHRRNTEIILQCSTACPFRTWGQNFNCIFCRVQSNDPNGLRAHMATRHADFDIGQVFNRKLRKEFLKVDITDLQCKLCFKRIDSIDDLMVHLKSDHKQPISTDVQPGVLPF----KLKDGS-------SWQCAICTIQFSDFISLKKHTSEHYQN--YVCDTCGEGFITDTALIAHTRIPH 382          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|943953443|ref|XP_014359615.1| (PREDICTED: zinc finger protein 28-like [Papilio machaon])

HSP 1 Score: 319.316 bits (817), Expect = 1.140e-102
Identity = 153/343 (44.61%), Postives = 220/343 (64.14%), Query Frame = 0
Query:   63 RKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNM 399
            +KN ++I+E++   PF++ K  ++C+YC   FL+P+ LREHN  +HS   ++       K KK+E +K++ T  +CK+C   + D  +LK HL   H+  I+    D +LP+K+S+D + C +C  ++E F SL+ HMN HF  YICE CG  F+T  R+  H+  H  G FPC  C + F S  A   H+A +H+  +R++CP C E F +Y  R KH+S+VHG  +  F C LCP+VF+L  +   H R  HL+ + + C  C  KF+S  EL+ H IKH GER YQC+VCKK+YAR  TL EHMRIH++DRR+ C  CG+SF+QNCSLK H++VHHPT +
Sbjct:   46 KKNSTLILEAAKLCPFRWMKNLFICFYCDQQFLDPDALREHNNLEHSTPSLSQIEHEMSKQKKHEFVKVELTNVSCKICNQILHDIPSLKYHLMDRHDMYINS--NDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSELKFHMIKHGGERKYQCNVCKKAYARKYTLTEHMRIHDNDRRYSCGECGRSFVQNCSLKHHVKVHHPTTI 386          
BLAST of HiSeq13644 vs. genbank:protein
Match: gi|910311361|ref|XP_013163599.1| (PREDICTED: zinc finger protein 675 isoform X4 [Papilio xuthus])

HSP 1 Score: 323.553 bits (828), Expect = 8.912e-102
Identity = 162/396 (40.91%), Postives = 240/396 (60.61%), Query Frame = 0
Query:   14 KSGQVPIVDEGREISTMQAVRQRKFVPTETIAATLVSPRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKLREHNKTQHSDVKIT------VKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLKTEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQYICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKVHRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCSRRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCKKSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMKNDV 403
            K  + P  D+  + +T Q  ++R+ +        +++P    +R+     KN ++I+E++   PF++ K  ++C+YC   FL+P+ LREHN  +HS   +        K KK+E +K++ T  +CK+C   + D  +LK HL   H+  I+    D +LP+K+S+D + C +C  ++E F SL+ HMN HF  YICE CG  F+T  R+  H+  H  G FPC  C + F S  A   H+A +H+  +R++CP C E F +Y  R KH+S+VHG  +  F C LCP+VF+L  +   H R  HL+ + + C  C  KF+S  EL+ H IKH GER YQC+VCKK+YAR  TL EHMRIH++DRR+ C  CG+SF+QNCSLK H++VHHP  +K D 
Sbjct:  216 KGSESPCEDQKDKSNTGQQKKKRRNI--------ILNPEILKERK-----KNSTLILEAAKLCPFRWMKNLFICFYCDQQFLDPDTLREHNNLEHSTPSLAQIEHEMSKQKKHEFVKVELTNVSCKICNHILHDIPSLKYHLMDRHDMYINS--NDGILPFKISKDNFVCILCSTKFETFKSLNHHMNVHFQNYICEQCGSGFITPDRLRAHSVIHVNGSFPCEECHKVFRSNTARTEHIANIHKKCKRHRCPECHEGFRNYFQRNKHISSVHGMTLKEFKCDLCPRVFNLSGKLRVHFRTVHLKMKRYTCEVCDWKFYSKSELKFHMIKHGGERKYQCNVCKKAYARKYTLTEHMRIHDNDRRYACGECGRSFVQNCSLKHHIKVHHPNIVKMDA 596          
The following BLAST results are available for this feature:
BLAST of HiSeq13644 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910311417|ref|XP_013163806.1|0.000e+073.26PREDICTED: zinc finger protein OZF-like [Papilio x... [more]
gi|943953423|ref|XP_014359604.1|0.000e+072.14PREDICTED: zinc finger protein 260-like isoform X4... [more]
gi|909558287|ref|XP_013134151.1|0.000e+071.87PREDICTED: zinc finger protein OZF-like [Papilio p... [more]
gi|930673783|gb|KPJ14216.1|5.217e-8872.60Zinc finger protein 729 [Papilio machaon][more]
gi|768414104|ref|XP_011569200.1|0.000e+068.44PREDICTED: zinc finger protein 26-like isoform X7 ... [more]
gi|357631484|gb|EHJ78957.1|1.286e-5966.23hypothetical protein KGM_06923 [Danaus plexippus][more]
gi|827547996|ref|XP_012546262.1|1.164e-17261.52PREDICTED: gastrula zinc finger protein XlCGF26.1-... [more]
gi|914573733|gb|KOB76193.1|2.681e-17273.21Uncharacterized protein OBRU01_06181, partial [Ope... [more]
gi|943953443|ref|XP_014359615.1|1.140e-10244.61PREDICTED: zinc finger protein 28-like [Papilio ma... [more]
gi|910311361|ref|XP_013163599.1|8.912e-10240.91PREDICTED: zinc finger protein 675 isoform X4 [Pap... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003677 DNA binding
molecular_function GO:0046872 metal ion binding
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015880Zinc finger, C2H2-likeSMARTSM00355ZnF_C2H2coord: 228..251
e-value: 0.036
score: 23.2
coord: 130..153
e-value: 3.6
score: 16.6
coord: 372..394
e-value: 0.0028
score: 26.9
coord: 344..366
e-value: 1.5E-4
score: 31.1
coord: 201..223
e-value: 0.026
score: 23.7
coord: 257..280
e-value: 0.0032
score: 26.7
coord: 287..310
e-value: 9.3
score: 13.6
coord: 316..338
e-value: 0.25
score: 20.4
coord: 175..197
e-value: 0.48
score: 19.5
coord: 85..108
e-value: 5.4
score: 15.7
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 315..345
e-value: 3.5E-6
score: 26.4
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 366..395
e-value: 1.9E-10
score: 39.6
coord: 190..224
e-value: 1.4E-4
score: 20.9
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3D3.30.160.60coord: 346..365
e-value: 6.4E-9
score: 35.0
NoneNo IPR availablePFAMPF13465zf-H2C2_2coord: 331..354
e-value: 4.5E-6
score: 26.5
NoneNo IPR availablePFAMPF13894zf-C2H2_4coord: 257..280
e-value: 6.6E-4
score: 19.7
coord: 175..197
e-value: 0.15
score: 12.3
coord: 132..153
e-value: 1.0
score: 9.7
coord: 228..251
e-value: 0.027
score: 14.6
NoneNo IPR availablePFAMPF12756zf-C2H2_2coord: 85..120
e-value: 0.63
score: 10.0
NoneNo IPR availablePANTHERPTHR24375:SF106HERMAPHRODITE-RELATEDcoord: 85..394
NoneNo IPR availablePANTHERPTHR24375FAMILY NOT NAMEDcoord: 85..394
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..2
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 18..405
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..17
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 3..12
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 13..17
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 175..223
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 227..276
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 338..390
NoneNo IPR availableSUPERFAMILY57667beta-beta-alpha zinc fingerscoord: 286..344
IPR007087Zinc finger, C2H2PFAMPF00096zf-C2H2coord: 372..394
e-value: 0.0011
score: 19.0
coord: 201..223
e-value: 0.0016
score: 18.5
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 374..395
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 203..223
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 346..366
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 230..251
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 259..280
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 176..197
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 318..338
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 289..310
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 87..108
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 132..153
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 257..285
score: 8.871
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 344..371
score: 12.695
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 175..202
score: 10.346
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 228..256
score: 8.974
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 85..113
score: 9.993
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 201..223
score: 11.427
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 372..394
score: 11.593
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 287..315
score: 9.743
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 316..343
score: 11.552

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13644HiSeq13644Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13644_p ID=HiSeq13644_p|Name=HiSeq13644|organism=Ostrinia scapulalis|type=polypeptide|length=405bp
MKIXISAVFLFLGKSGQVPIVDEGREISTMQAVRQRKFVPTETIAATLVS
PRDTADRRRILFRKNISIIIESSTAYPFKYRKGTYMCYYCRNTFLEPEKL
REHNKTQHSDVKITVKPKKYEPLKMDFTVTTCKLCGVDIPDYTNLKLHLK
TEHNKTIDCTYGDSVLPYKLSRDEYCCQICGKRYEMFLSLHRHMNEHFGQ
YICENCGKNFVTQHRMANHARTHERGVFPCRLCKETFASYAAMCTHVAKV
HRSNQRYKCPICDEKFASYKHRVKHLSTVHGEKITVFPCALCPKVFDLCS
RRTAHIRFQHLQERNHVCHECGMKFFSNHELQEHSIKHNGERIYQCDVCK
KSYARLKTLREHMRIHNDDRRFVCFVCGQSFIQNCSLKQHMRVHHPTNMK
NDVRI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0046872metal ion binding
GO:0003676nucleic acid binding
Vocabulary: INTERPRO
TermDefinition
IPR007087Znf_C2H2
IPR013087Znf_C2H2/integrase_DNA-bd
IPR015880Znf_C2H2-like