HiSeq13655_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13655
Unique NameHiSeq13655_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length275
Homology
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|913308285|ref|XP_013184671.1| (PREDICTED: uncharacterized protein LOC106130383 [Amyelois transitella])

HSP 1 Score: 409.068 bits (1050), Expect = 4.771e-142
Identity = 189/276 (68.48%), Postives = 240/276 (86.96%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHN-DELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADECE 275
            ML  L+L+ IS  ++E C YV+D Q+Y RT+ILTI+GLPTNL  NP+  DI FTLIDL+SL NDD QTKM+QY L+NG P+KIDN++GQAAAVD   NK+YIASDDGLNVLNKT+KA F+SLKDEDIV ++KP++  DELY VIYP+NEVY++NLK+NEK+++D++PCAFILAVDS++N++YEC++KYVKVLLK FQEPIEF GI +++ARA+TVDG++RV+LAANDGLY LRPDS+IPRKLM+LDF+PSGI F  +D+YLA+N +IYKYS  ECE
Sbjct:    1 MLPLLVLLVISKASAELCPYVFDNQSYSRTSILTIRGLPTNLVHNPHTGDILFTLIDLESLQNDDVQTKMEQYILKNGEPIKIDNINGQAAAVDIARNKIYIASDDGLNVLNKTNKATFVSLKDEDIVQVFKPQNTMDELYVVIYPENEVYTVNLKRNEKRRVDHVPCAFILAVDSNENVFYECDSKYVKVLLKGFQEPIEFVGIAKDSARAITVDGSDRVILAANDGLYHLRPDSLIPRKLMSLDFVPSGIAFHDEDIYLAANSMIYKYSTAECE 276          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|943947734|ref|XP_014356968.1| (PREDICTED: uncharacterized protein LOC106709630 [Papilio machaon] >gi|943947737|ref|XP_014356969.1| PREDICTED: uncharacterized protein LOC106709630 [Papilio machaon])

HSP 1 Score: 388.652 bits (997), Expect = 5.481e-134
Identity = 177/274 (64.60%), Postives = 234/274 (85.40%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADEC 274
            M+  L+LI ++SV +  C+Y+YD  +Y RT++LTIKGLPTNLA NPNN D+ FTLIDL+SLH+D+ QT+MDQY LRNG P+ IDNV GQA+AVD KNN+VYIASDDG+ +LN +DK  F +LKDED+V LYKP ++++LYAV YP+NEV+ I+ K NEK++I+ +PCAFILAVD+++NI+YEC++KYVKVLLKDFQEPIEF GI +N+ARA+T+D +NRV+LAANDGLY L+PD+++P+KLMNLDF+PSGI  + D +YLA+NG+IYKY+ D C
Sbjct:    1 MITILILIVVTSVYANNCSYIYDDIHYTRTSVLTIKGLPTNLAYNPNNNDLHFTLIDLESLHDDNVQTRMDQYVLRNGEPILIDNVRGQASAVDVKNNRVYIASDDGIGILNASDKVQFANLKDEDVVYLYKPVNSEDLYAVTYPNNEVFVIDTKNNEKRRIEYVPCAFILAVDAENNIFYECDSKYVKVLLKDFQEPIEFVGIAKNSARALTIDESNRVILAANDGLYWLKPDNVVPKKLMNLDFVPSGIVLNEDVIYLATNGIIYKYTNDNC 274          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|909550290|ref|XP_013134204.1| (PREDICTED: uncharacterized protein LOC106100018 [Papilio polytes])

HSP 1 Score: 384.03 bits (985), Expect = 3.953e-132
Identity = 175/270 (64.81%), Postives = 230/270 (85.19%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYS 270
            M+  L+LI +SSV +  C+Y+YD  +Y R +ILTIKGLPTNLA NP N D+ FTLIDL+SLH+D+ QT+MDQY LRNG P+ IDNV GQAAAVD KN+KVYIASDDG+ +LN +DK  F +LKDED+V L+KP H+D+LYAV YP+NE+Y ++  KNEK++++ +PCAFILAVD++DN++YEC++KYVKVLL DFQEPIEF GI +N+ARA+TVD +NRV+LAANDGLY L+PD+++P+K+MNLDF+PSGI F+ D +Y+A+NG+IYKYS
Sbjct:    1 MIPLLILIVVSSVYANNCSYIYDEIHYTRNSILTIKGLPTNLAYNPKNNDVLFTLIDLESLHDDNVQTRMDQYVLRNGEPILIDNVRGQAAAVDVKNDKVYIASDDGIGILNASDKVQFANLKDEDVVQLFKPVHSDDLYAVTYPNNEIYVVDTIKNEKRRVEYVPCAFILAVDAEDNVFYECDSKYVKVLLNDFQEPIEFVGIAKNSARALTVDESNRVILAANDGLYWLKPDNIVPKKVMNLDFVPSGIVFNEDVIYIATNGMIYKYS 270          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|910348951|ref|XP_013178479.1| (PREDICTED: uncharacterized protein LOC106125723 [Papilio xuthus])

HSP 1 Score: 380.178 bits (975), Expect = 1.604e-130
Identity = 176/274 (64.23%), Postives = 229/274 (83.58%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADEC 274
            M+  L+L  ISSV ++ C+Y++D  +Y RT+ILTIKGLPTNLA NPNN DI+FTLIDL+SLH+D+ QTKMDQY LRNG P+ IDNV GQAAA+D KNNKVYIASDDG+ +LN ++K  F +LKDED+V LYK  + DELY V YP+NEV+ +++  NEK++++ IPCAFIL+VD+DDNI+YEC++KYVKVLLKDFQEPIEF GI +N+ARA+ +D +NRV+LAANDGLY L+PD+++P+KLM L+F+PSGI  +   +YLA+NGVIYKY+ D C
Sbjct:    1 MIPLLILTLISSVYADNCSYIFDDIHYTRTSILTIKGLPTNLAYNPNNNDIYFTLIDLESLHDDNVQTKMDQYVLRNGEPILIDNVRGQAAAIDVKNNKVYIASDDGIGILNASNKVQFSNLKDEDVVYLYKAVNKDELYVVTYPNNEVFVVDVNNNEKRRVEYIPCAFILSVDADDNIFYECDSKYVKVLLKDFQEPIEFVGIAKNSARALAIDESNRVILAANDGLYWLKPDTVVPKKLMKLEFVPSGIVLNDGVIYLATNGVIYKYTNDNC 274          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|914614942|ref|NP_001299346.1| (uncharacterized protein LOC106125723 precursor [Papilio xuthus] >gi|389609147|dbj|BAM18185.1| unknown secreted protein [Papilio xuthus] >gi|930659065|gb|KPJ01194.1| hypothetical protein RR46_03065 [Papilio xuthus])

HSP 1 Score: 379.407 bits (973), Expect = 2.993e-130
Identity = 175/274 (63.87%), Postives = 229/274 (83.58%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADEC 274
            M+  L+L  ISSV ++ C+Y++D  +Y RT+ILTIKGLPTNLA NPNN DI+FTLIDL+SLH+D+ QTKMDQY LRNG P+ IDNV GQAAA+D KNNKVYIASDDG+ +LN ++K  F +LKDED+V LYK  + DELY V YP+NEV+ +++  NEK++++ +PCAFIL+VD+DDNI+YEC++KYVKVLLKDFQEPIEF GI +N+ARA+ +D +NRV+LAANDGLY L+PD+++P+KLM L+F+PSGI  +   +YLA+NGVIYKY+ D C
Sbjct:    1 MIPLLILTLISSVYADNCSYIFDDIHYTRTSILTIKGLPTNLAYNPNNNDIYFTLIDLESLHDDNVQTKMDQYVLRNGEPILIDNVRGQAAAIDVKNNKVYIASDDGIGILNASNKVQFSNLKDEDVVYLYKAVNKDELYVVTYPNNEVFVVDVNNNEKRRVEYVPCAFILSVDADDNIFYECDSKYVKVLLKDFQEPIEFVGIAKNSARALAIDESNRVILAANDGLYWLKPDTVVPKKLMKLEFVPSGIVLNDGVIYLATNGVIYKYTNDNC 274          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|357626099|gb|EHJ76308.1| (hypothetical protein KGM_21135 [Danaus plexippus])

HSP 1 Score: 374.785 bits (961), Expect = 4.606e-128
Identity = 176/275 (64.00%), Postives = 233/275 (84.73%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADECE 275
            ML  LLL+A S V ++ C+ ++DG  Y R +ILTIKGLPTNLA N NNKD+ FT+ID+DSL NDD QTKMDQY L NG P+KID+++GQAAAVD KNN VYIASDDGL  LN T K +FL+ KDEDI ML+K  ++D+LYAV++PD+EVY I+L++NEKK+I N+PCAFILAVD  +NIYYEC++KYVKVLLKD+ EPIE+ G+ +N ARAMT+D NNRV+LAANDGLY L+PDS+IP+KLMNLDF+PSG+ F+G +++++++G+IY++++++CE
Sbjct:   28 MLILLLLVA-SPVFADNCSDLFDGVLYSRRSILTIKGLPTNLAYNQNNKDLHFTVIDIDSLQNDDVQTKMDQYVLANGQPIKIDDINGQAAAVDNKNNIVYIASDDGLATLNATYKTNFLAFKDEDITMLFKATNDDKLYAVLFPDSEVYEIDLQRNEKKRIKNVPCAFILAVDDAENIYYECDSKYVKVLLKDYVEPIEYVGLAKNAARAMTIDDNNRVILAANDGLYWLQPDSLIPKKLMNLDFVPSGVVFNGHNLFISTSGIIYEFNSEDCE 301          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|768436471|ref|XP_011559723.1| (PREDICTED: uncharacterized protein LOC105390170 [Plutella xylostella])

HSP 1 Score: 363.999 bits (933), Expect = 4.853e-124
Identity = 170/274 (62.04%), Postives = 220/274 (80.29%), Query Frame = 0
Query:    2 LRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSADECE 275
            L  L L+A ++  SE C Y +D + Y RTA+LTIKGLP+NLA NP   D+FFTLIDLDSL +D+ QTKMDQY L N +P KID VHGQA A+D + N VY+A+D+GL+ LN+T +  FLSLKDEDI+ L K    DELYAV+YPDNEV  +++K+NEK+ + N+PC +I+AVD +DN+YYEC++KY+KVLLK FQEPIEFAGI ++TARA+TVD  NRV+LA NDGLYQL+PD +IP+KLM+L++ PSGI FDGDDMY+++ GVIYKYS  +C+
Sbjct:    4 LLMLTLVATTTAISEDCVYRFDNKLYTRTALLTIKGLPSNLAHNPATNDLFFTLIDLDSLTDDEVQTKMDQYVLHNNVPTKIDGVHGQAVAIDKRRNIVYLATDNGLHTLNETYQPTFLSLKDEDIIQLNKHMIKDELYAVLYPDNEVIVLDIKRNEKRPVKNVPCTYIMAVDMEDNVYYECDSKYLKVLLKGFQEPIEFAGIAKDTARAITVDRQNRVILATNDGLYQLKPDRVIPKKLMDLEYWPSGIEFDGDDMYVSTTGVIYKYSNKDCK 277          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|930675923|gb|KPJ16155.1| (hypothetical protein RR48_01752 [Papilio machaon])

HSP 1 Score: 370.163 bits (949), Expect = 9.436e-123
Identity = 170/264 (64.39%), Postives = 225/264 (85.23%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNG 264
            M+  L+LI ++SV +  C+Y+YD  +Y RT++LTIKGLPTNLA NPNN D+ FTLIDL+SLH+D+ QT+MDQY LRNG P+ IDNV GQA+AVD KNN+VYIASDDG+ +LN +DK  F +LKDED+V LYKP ++++LYAV YP+NEV+ I+ K NEK++I+ +PCAFILAVD+++NI+YEC++KYVKVLLKDFQEPIEF GI +N+ARA+T+D +NRV+LAANDGLY L+PD+++P+KLMNLDF+PSGI  + D +YLA+N 
Sbjct:    1 MITILILIVVTSVYANNCSYIYDDIHYTRTSVLTIKGLPTNLAYNPNNNDLHFTLIDLESLHDDNVQTRMDQYVLRNGEPILIDNVRGQASAVDVKNNRVYIASDDGIGILNASDKVQFANLKDEDVVYLYKPVNSEDLYAVTYPNNEVFVIDTKNNEKRRIEYVPCAFILAVDAENNIFYECDSKYVKVLLKDFQEPIEFVGIAKNSARALTIDESNRVILAANDGLYWLKPDNVVPKKLMNLDFVPSGIVLNEDVIYLATNA 264          

HSP 2 Score: 95.5153 bits (236), Expect = 1.100e-18
Identity = 67/276 (24.28%), Postives = 131/276 (47.46%), Query Frame = 0
Query:    5 LLLIAISSVASEPCAYVYDGQN-YERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNG------MPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLS---LKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDG-DDMYLASNGVIYKY 269
            +++ + ++   E C  +  G   Y+R  + TI G PT L ++P  +++FF L      H  +    +  + LR G      +P+  D++ GQ   +D  NN +YI ++ G+   NK DK    S   + D+D+  ++  + ++ +Y    P +E++         K+ + +P A+   +D+  N +YE     +     D  EPI++ G  R     + ++  +  +LA    LY+L   S+ P K+  L    + + FD  +++ + + G IY+Y
Sbjct:  271 MIICSTATHDGEKCEKIKIGSEFYKRQLVATIDGYPTGLVMDPRTENMFFLL------HKRNYTRGI--HILRYGALGVQEIPIS-DDLTGQCVGIDVFNNIIYIGTNQGITTYNK-DKNQITSERPIGDDDVRSIFFDKRDNLMYITTGPQHEIFKFINGSAAVKRYEKVPRAYNFILDAKGNAFYEYVDGRLYFFSVDLFEPIQYKGFTRELKYILQLNNFDEAILAVKSSLYRLTTSSIFPEKIAQLGTKITALFFDAKNNIIIGTKGKIYRY 536          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|512895721|ref|XP_004923739.1| (PREDICTED: uncharacterized protein LOC101739160 [Bombyx mori])

HSP 1 Score: 351.673 bits (901), Expect = 2.355e-119
Identity = 173/272 (63.60%), Postives = 222/272 (81.62%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDD--MYLASNGVIYKYS 270
            ML+++LL+ +++ AS+ C++ +DG  Y RTAIL+IKGLPTNL  NP N+D+ FTLIDL++L +D+ QTKMDQY LR G  +KIDNV GQA+AVD K NKVYIASDDGLN LN TDKA+F+ LKD+DIV LYKP H DELYAV++P+N VY I+++KNEK+K++ IPCAF L VD  DNI+YEC++KYVKVLLK FQEPIEF GI +N+ +A+ VDG  RV+LAA DGLY LRPD++IP KLM LDF PSGI F+ +D  +YL++N VIY+Y+
Sbjct:    1 MLQFVLLLVVAAAASKNCSFYFDGHPYSRTAILSIKGLPTNLVYNPANQDLLFTLIDLETLQDDNIQTKMDQYILREGNTIKIDNVRGQASAVDMKRNKVYIASDDGLNELNSTDKANFVGLKDDDIVQLYKPRHGDELYAVLFPENAVYIIDIEKNEKRKVEYIPCAFYLGVDDKDNIFYECDSKYVKVLLKGFQEPIEFVGIAKNSGKAIAVDGIGRVILAATDGLYHLRPDNVIPNKLMELDFYPSGIAFNEEDNRIYLSTNDVIYRYN 272          
BLAST of HiSeq13655 vs. genbank:protein
Match: gi|914575611|gb|KOB77633.1| (Uncharacterized protein OBRU01_03134 [Operophtera brumata])

HSP 1 Score: 353.214 bits (905), Expect = 9.827e-116
Identity = 165/272 (60.66%), Postives = 219/272 (80.51%), Query Frame = 0
Query:    1 MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDGDDMYLASNGVIYKYSAD 272
            M+  LLL+ I++ +++ C++ +DG +Y R+ ILT KGLPTNL  NPNNKD+ FTLID++SL++D  QTKMDQY LRNG  +K+D ++GQAAAVD  NNKVYI ++ GL V+N+T KA+F+++ +EDIV L+KP H + LYA ++PDNEV+ I+L KNEK K++NIPCA+ LAVD  DNIYYECN+KYVKVLLK F EPIE+ GI +N+ RA+ VD   R VLA+NDGLY LRPD+MIP KLM+LD  P+G+ F+GDD+YL++NGVIYKYS +
Sbjct:    1 MMLPLLLLVIAAASAKNCSHYFDGNHYTRSTILTTKGLPTNLVHNPNNKDLLFTLIDIESLNDDHVQTKMDQYVLRNGGLIKVDIINGQAAAVDVINNKVYIGTESGLAVMNETLKANFINMINEDIVQLFKPTHENVLYATLFPDNEVFIIDLDKNEKTKVENIPCAYFLAVDDKDNIYYECNSKYVKVLLKGFHEPIEYVGIAKNSGRAIAVDKIGRAVLASNDGLYHLRPDNMIPVKLMDLDITPAGLAFEGDDIYLSTNGVIYKYSME 272          

HSP 2 Score: 103.605 bits (257), Expect = 2.417e-21
Identity = 70/276 (25.36%), Postives = 135/276 (48.91%), Query Frame = 0
Query:    5 LLLIAISSVASEPCAYVYDGQNY-ERTAILTIKGLPTNLAINPNNKDIFFTLIDLDSLHNDDEQTKMDQYFLRNG------MPMKIDNVHGQAAAVDAKNNKVYIASDDGLNVL--NKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVYSINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIEFAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSGITFDG-DDMYLASNGVIYKYS 270
            ++ I I    +E C     G  Y +R  I TI G PT + I+    +IFF L      H  +    +  + L++G      +P+  D++ GQ  A+D  N  VYI ++ GL     ++T+      + D+DI  ++  + ++++Y      +E++         K+ + IP A+   +D+  N++YE     +     D+ EP+++ G  R     + ++ N+  ++A    L++L   SM+P+K+  L F  +G+ FD  ++M + + G +YKY+
Sbjct:  292 VIFILIQGRKAEKCDRTKLGHEYFKRQLIATIDGYPTGIVIDSRTDNIFFIL------HKRNYTKGI--HLLKHGSLGIKELPVS-DDLVGQCVAIDDTNGMVYIGTNQGLVTYDYSRTEITGERPIGDDDIRNIFIDQSDNQMYITTGSSHEIFKFINGSAAVKRYEKIPRAYSFVLDAKGNVFYEYVDGRMYFFSTDYYEPVQYKGFTRELKYILQMNVNDEAIVAVKGSLFKLTTKSMLPQKIGQLGFKITGMAFDTKNNMVVGTKGKLYKYN 558          
The following BLAST results are available for this feature:
BLAST of HiSeq13655 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913308285|ref|XP_013184671.1|4.771e-14268.48PREDICTED: uncharacterized protein LOC106130383 [A... [more]
gi|943947734|ref|XP_014356968.1|5.481e-13464.60PREDICTED: uncharacterized protein LOC106709630 [P... [more]
gi|909550290|ref|XP_013134204.1|3.953e-13264.81PREDICTED: uncharacterized protein LOC106100018 [P... [more]
gi|910348951|ref|XP_013178479.1|1.604e-13064.23PREDICTED: uncharacterized protein LOC106125723 [P... [more]
gi|914614942|ref|NP_001299346.1|2.993e-13063.87uncharacterized protein LOC106125723 precursor [Pa... [more]
gi|357626099|gb|EHJ76308.1|4.606e-12864.00hypothetical protein KGM_21135 [Danaus plexippus][more]
gi|768436471|ref|XP_011559723.1|4.853e-12462.04PREDICTED: uncharacterized protein LOC105390170 [P... [more]
gi|930675923|gb|KPJ16155.1|9.436e-12364.39hypothetical protein RR48_01752 [Papilio machaon][more]
gi|512895721|ref|XP_004923739.1|2.355e-11963.60PREDICTED: uncharacterized protein LOC101739160 [B... [more]
gi|914575611|gb|KOB77633.1|9.827e-11660.66Uncharacterized protein OBRU01_03134 [Operophtera ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 20..107
e-value: 6.8E-9
score: 34.6
coord: 147..261
e-value: 6.8E-9
score: 34.6
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 16..275
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 11..15
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 5..10
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..4
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..15
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.699
NoneNo IPR availableSUPERFAMILY63825YWTD domaincoord: 94..271
coord: 19..54

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13655HiSeq13655Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13655_p ID=HiSeq13655_p|Name=HiSeq13655|organism=Ostrinia scapulalis|type=polypeptide|length=275bp
MLRYLLLIAISSVASEPCAYVYDGQNYERTAILTIKGLPTNLAINPNNKD
IFFTLIDLDSLHNDDEQTKMDQYFLRNGMPMKIDNVHGQAAAVDAKNNKV
YIASDDGLNVLNKTDKAHFLSLKDEDIVMLYKPEHNDELYAVIYPDNEVY
SINLKKNEKKKIDNIPCAFILAVDSDDNIYYECNAKYVKVLLKDFQEPIE
FAGIGRNTARAMTVDGNNRVVLAANDGLYQLRPDSMIPRKLMNLDFIPSG
ITFDGDDMYLASNGVIYKYSADECE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom