HiSeq13672_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13672
Unique NameHiSeq13672_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length179
Homology
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|1073537561|gb|JAT85892.1| (hypothetical protein g.2540 [Pectinophora gossypiella])

HSP 1 Score: 278.87 bits (712), Expect = 1.699e-93
Identity = 131/175 (74.86%), Postives = 153/175 (87.43%), Query Frame = 0
Query:    6 FFGQPPKELALAYVH-NPAPLAPRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             F  PP+ELALAY+H N  P   +KFSL+D++GDGFLMAVPKFRRT+EKRLKRKFGSP+YV K+L PKTNI VC +CGHH+E GRLCG+CYKK+E ETKEIQ KI EKL   PI+K+V+VLYEGEN+PD+PKEFW+GKRIIEMKKERP WFSKNLLQKSTQ+PS++ DVKPTDLA
Sbjct:   22 MFVHPPRELALAYIHENKTPTPQKKFSLKDLVGDGFLMAVPKFRRTVEKRLKRKFGSPEYVWKMLVPKTNIKVCSDCGHHHERGRLCGNCYKKVEQETKEIQAKIKEKLGLEPIEKDVVVLYEGENLPDEPKEFWQGKRIIEMKKERPQWFSKNLLQKSTQQPSNATDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|930648947|gb|KPI91295.1| (39S ribosomal protein L32, mitochondrial [Papilio xuthus])

HSP 1 Score: 276.174 bits (705), Expect = 2.688e-92
Identity = 132/175 (75.43%), Postives = 149/175 (85.14%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHNPAPLAPRK-FSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FG PPKELAL  ++   P  P+K FS++D++GDGFL+AVPKFRRTIEKRLKRK+G P+YV K+L PKTNI VC ECGHH+E GRLC HCYKK+E ETKEIQ KI EKL NSPI+K+VIVLYEGEN PD PKEFW GKRI+EMKKERP WFSKNLLQKSTQ+PSDS DVKPTDLA
Sbjct:   22 LFGHPPKELALVQIYEKQPTHPKKSFSIKDIVGDGFLLAVPKFRRTIEKRLKRKYGYPEYVWKMLVPKTNIKVCNECGHHHERGRLCEHCYKKVEIETKEIQAKIQEKLGNSPIEKDVIVLYEGENPPDTPKEFWNGKRIVEMKKERPQWFSKNLLQKSTQQPSDSTDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|914615342|ref|NP_001298805.1| (39S ribosomal protein L32, mitochondrial [Papilio xuthus] >gi|389609577|dbj|BAM18400.1| mitochondrial ribosomal protein L32 [Papilio xuthus])

HSP 1 Score: 275.018 bits (702), Expect = 5.788e-92
Identity = 131/175 (74.86%), Postives = 149/175 (85.14%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHNPAPLAPRK-FSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FG PP+ELAL  ++   P  P+K FS++D++GDGFL+AVPKFRRTIEKRLKRK+G P+YV K+L PKTNI VC ECGHH+E GRLC HCYKK+E ETKEIQ KI EKL NSPI+K+VIVLYEGEN PD PKEFW GKRI+EMKKERP WFSKNLLQKSTQ+PSDS DVKPTDLA
Sbjct:   22 MFGHPPRELALVQIYEKQPTHPKKSFSIKDIVGDGFLLAVPKFRRTIEKRLKRKYGYPEYVWKMLVPKTNIKVCNECGHHHERGRLCEHCYKKVEIETKEIQAKIQEKLGNSPIEKDVIVLYEGENPPDTPKEFWNGKRIVEMKKERPQWFSKNLLQKSTQQPSDSTDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|914563722|gb|KOB69433.1| (Mitochondrial ribosomal protein L32 [Operophtera brumata])

HSP 1 Score: 269.626 bits (688), Expect = 7.668e-90
Identity = 127/175 (72.57%), Postives = 150/175 (85.71%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHNPAPLAP-RKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FG PP+ELALAYVH   P AP +K SL+D++GDGFL+AVPKFRRT+EKR KRKFGSPQYV K+L+PKTNI+VC  CGHH+E   LC +CYK++E ETK I++KI+EKL N PI+++V+VLYEGENVP+QP EFWKGKRIIEMKKERP WFSKNLLQK+TQ PS S DVKPTDLA
Sbjct:   22 MFGHPPRELALAYVHENQPSAPPKKHSLKDIVGDGFLLAVPKFRRTLEKRWKRKFGSPQYVWKMLEPKTNIIVCHTCGHHHERKCLCENCYKRVEEETKLIKDKIIEKLGNQPIEQDVVVLYEGENVPEQPDEFWKGKRIIEMKKERPQWFSKNLLQKTTQAPSKSTDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|943970165|ref|XP_014366787.1| (PREDICTED: 39S ribosomal protein L32, mitochondrial [Papilio machaon] >gi|930667807|gb|KPJ08873.1| 39S ribosomal protein L32, mitochondrial [Papilio machaon])

HSP 1 Score: 268.47 bits (685), Expect = 2.824e-89
Identity = 127/175 (72.57%), Postives = 147/175 (84.00%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHNPAPLAPRK-FSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FG PP+ELAL  ++      P+K FS++D++GDGFL+AVPKFRRTIEK+LKRKFG P+YV K+L PKTNI VC ECGHH+E GRLC HCYKK+E ETKEIQ KI EKL NSPI+K+VIVLYEGEN P+ P EFW GKR++EMKKERP WFSKNLLQKSTQ+PSDS DVKPTDLA
Sbjct:   22 MFGHPPRELALVQIYEKQIPHPKKRFSIKDIVGDGFLLAVPKFRRTIEKKLKRKFGYPEYVWKMLVPKTNIKVCNECGHHHERGRLCEHCYKKVEKETKEIQAKIQEKLGNSPIEKDVIVLYEGENAPNTPNEFWNGKRVVEMKKERPQWFSKNLLQKSTQQPSDSTDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|909566806|ref|XP_013138792.1| (PREDICTED: 39S ribosomal protein L32, mitochondrial [Papilio polytes])

HSP 1 Score: 267.314 bits (682), Expect = 8.083e-89
Identity = 125/175 (71.43%), Postives = 149/175 (85.14%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHN-PAPLAPRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FG PP+ELAL  ++  P+P   + F+++D++GDGFL+AVPKFRRTIEK+ KRKFG  +YV K+L PKTNI+VC +CGHH+E GRLC  CYKK+E ETKEIQ+KI EKL NSPI+K+VIVLYEGEN P+ PKEFW GKRI+EMKKERP WFSKNLLQKSTQ+PSDSKDVKPTDLA
Sbjct:   22 MFGHPPRELALVQIYEKPSPQPKKSFTIKDIVGDGFLLAVPKFRRTIEKKWKRKFGYSEYVWKMLVPKTNIIVCNDCGHHHERGRLCECCYKKVEKETKEIQDKIQEKLGNSPIEKDVIVLYEGENAPNMPKEFWNGKRIVEMKKERPQWFSKNLLQKSTQQPSDSKDVKPTDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|768439925|ref|XP_011561619.1| (PREDICTED: 39S ribosomal protein L32, mitochondrial [Plutella xylostella])

HSP 1 Score: 262.692 bits (670), Expect = 4.756e-87
Identity = 122/175 (69.71%), Postives = 142/175 (81.14%), Query Frame = 0
Query:    6 FFGQPPKELALAYVH-NPAPLAPRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             FGQPP+ELALAYVH NP P   +KF+L D++GDG L A+PK RRT+EKR+KRKFG P Y  K+L PKTNILVC ECGH+YE   LC +CY K+E ETKEIQ +I EKL   P++K+V+VLYEGE  PDQPKEFW GKRIIEMKKERP WFSKNLLQK+TQ+PS+S DVKP DLA
Sbjct:   22 IFGQPPRELALAYVHENPTPAPGKKFTLADLVGDGILYAMPKSRRTVEKRMKRKFGHPDYNYKLLLPKTNILVCTECGHNYERAHLCANCYNKVEKETKEIQAQIREKLGTGPVEKDVVVLYEGETTPDQPKEFWNGKRIIEMKKERPKWFSKNLLQKTTQQPSNSTDVKPKDLA 196          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|357622404|gb|EHJ73897.1| (mitochondrial ribosomal protein L32 [Danaus plexippus])

HSP 1 Score: 261.151 bits (666), Expect = 3.583e-86
Identity = 123/176 (69.89%), Postives = 154/176 (87.50%), Query Frame = 0
Query:    6 FFGQPPKELALAYVHN-PAPLAPRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKL-SNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
             F  PP+ELALA+ ++ P+    +KFSL D+IGDGFL+AVPKFRRT+EKR KRKFGSP Y+ K+L PKTNI+VC ECGH++E+GRLCG+CYKK+E+ETKEIQEKI EKL +N PI+ +VIVLY+G+ +P++P+EFW+GKR+IEMKKERP WFSKNLLQK+TQ PS+SKDVKPTDLA
Sbjct:   39 MFKYPPRELALAFDYDKPSEKITKKFSLNDLIGDGFLLAVPKFRRTVEKRWKRKFGSPDYIWKMLVPKTNIIVCYECGHYHENGRLCGNCYKKVEAETKEIQEKIQEKLGTNKPIENDVIVLYDGDQLPEKPQEFWQGKRVIEMKKERPKWFSKNLLQKTTQAPSESKDVKPTDLA 214          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|913318344|ref|XP_013190197.1| (PREDICTED: 39S ribosomal protein L32, mitochondrial [Amyelois transitella])

HSP 1 Score: 259.225 bits (661), Expect = 1.140e-85
Identity = 122/178 (68.54%), Postives = 148/178 (83.15%), Query Frame = 0
Query:    4 NSFFGQPPKELALAYV--HNPAPLAPRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
            N  FG PPKE ++ YV   N  P+   K S++D+IGDG L AVPKFRRT+EKRLKRKFGSP YV K+L+ KTN+ VC++CGHHYESGRLCG+CY K++ ET+EI++KI EKL   PI+K+VIVLYEG++ P+QP EFWKGKRIIEM+KERP WFSKNLLQK+TQ+PSDS DVKPTDLA
Sbjct:   21 NRVFGGPPKEFSIVYVGDSNQTPIRS-KMSIKDIIGDGILFAVPKFRRTVEKRLKRKFGSPDYVWKMLEVKTNLKVCRDCGHHYESGRLCGNCYSKVKEETEEIKQKIQEKLGTGPIEKDVIVLYEGDSTPEQPPEFWKGKRIIEMQKERPQWFSKNLLQKTTQKPSDSTDVKPTDLA 197          
BLAST of HiSeq13672 vs. genbank:protein
Match: gi|148298659|ref|NP_001091811.1| (mitochondrial ribosomal protein L32 [Bombyx mori] >gi|87248541|gb|ABD36323.1| mitochondrial ribosomal protein L32 [Bombyx mori])

HSP 1 Score: 258.84 bits (660), Expect = 1.516e-85
Identity = 125/176 (71.02%), Postives = 144/176 (81.82%), Query Frame = 0
Query:    5 SFFGQPPKELALAYVHNPAPL-APRKFSLQDVIGDGFLMAVPKFRRTIEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIESETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKERPHWFSKNLLQKSTQEPSDSKDVKPTDLA 179
            S FG PPKELALA   N  P   P+ FS+ D+IGDGFL+AVPKFRRT+EKRL RKFG P+YV K   PKTN+  C ECGHH+E GRLCG+CYKKI  ETKEIQ +I++KL + PI+++VIVLYEGE +PDQ KEFWKGKRI+EMKKERP WFSKNLLQKSTQ+PS S DVKPTDLA
Sbjct:   22 SLFGHPPKELALAVSVNQQPKPTPKAFSIHDLIGDGFLLAVPKFRRTVEKRLNRKFGWPEYVWKPFVPKTNLKTCHECGHHHEQGRLCGNCYKKIGKETKEIQGEILKKLGSGPIEQDVIVLYEGETLPDQQKEFWKGKRIVEMKKERPQWFSKNLLQKSTQQPSKSTDVKPTDLA 197          
The following BLAST results are available for this feature:
BLAST of HiSeq13672 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1073537561|gb|JAT85892.1|1.699e-9374.86hypothetical protein g.2540 [Pectinophora gossypie... [more]
gi|930648947|gb|KPI91295.1|2.688e-9275.4339S ribosomal protein L32, mitochondrial [Papilio ... [more]
gi|914615342|ref|NP_001298805.1|5.788e-9274.8639S ribosomal protein L32, mitochondrial [Papilio ... [more]
gi|914563722|gb|KOB69433.1|7.668e-9072.57Mitochondrial ribosomal protein L32 [Operophtera b... [more]
gi|943970165|ref|XP_014366787.1|2.824e-8972.57PREDICTED: 39S ribosomal protein L32, mitochondria... [more]
gi|909566806|ref|XP_013138792.1|8.083e-8971.43PREDICTED: 39S ribosomal protein L32, mitochondria... [more]
gi|768439925|ref|XP_011561619.1|4.756e-8769.71PREDICTED: 39S ribosomal protein L32, mitochondria... [more]
gi|357622404|gb|EHJ73897.1|3.583e-8669.89mitochondrial ribosomal protein L32 [Danaus plexip... [more]
gi|913318344|ref|XP_013190197.1|1.140e-8568.54PREDICTED: 39S ribosomal protein L32, mitochondria... [more]
gi|148298659|ref|NP_001091811.1|1.516e-8571.02mitochondrial ribosomal protein L32 [Bombyx mori] ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
cellular_component GO:0015934 large ribosomal subunit
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR21026:SF239S RIBOSOMAL PROTEIN L32, MITOCHONDRIALcoord: 22..158
NoneNo IPR availablePANTHERPTHR2102639S RIBOSOMAL PROTEIN L32, MITOCHONDRIALcoord: 22..158
IPR011332Zinc-binding ribosomal proteinSUPERFAMILY57829Zn-binding ribosomal proteinscoord: 40..103

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13672HiSeq13672Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13672_p ID=HiSeq13672_p|Name=HiSeq13672|organism=Ostrinia scapulalis|type=polypeptide|length=179bp
MFXNSFFGQPPKELALAYVHNPAPLAPRKFSLQDVIGDGFLMAVPKFRRT
IEKRLKRKFGSPQYVLKILQPKTNILVCKECGHHYESGRLCGHCYKKIES
ETKEIQEKIVEKLSNSPIDKEVIVLYEGENVPDQPKEFWKGKRIIEMKKE
RPHWFSKNLLQKSTQEPSDSKDVKPTDLA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0015934large ribosomal subunit
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR011332Ribosomal_zn-bd